SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603221|ref|NP_246295.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603221|ref|NP_246295.1|
Domain Number 1 Region: 6-287
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.02e-109
Family G proteins 0.0000000282
Further Details:      
 
Domain Number 2 Region: 484-606
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-40
Family Translational machinery components 0.0000123
Further Details:      
 
Domain Number 3 Region: 271-409
Classification Level Classification E-value
Superfamily Translation proteins 3.98e-35
Family Elongation factors 0.0000956
Further Details:      
 
Domain Number 4 Region: 607-697
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.65e-26
Family EF-G/eEF-2 domains III and V 0.00024
Further Details:      
 
Domain Number 5 Region: 407-485
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.51e-25
Family EF-G/eEF-2 domains III and V 0.0000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603221|ref|NP_246295.1|
Sequence length 700
Comment elongation factor G [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MARTTPIERYRNIGISAHIDAGKTTTSERILFYTGVSHKLGEVHDGAATMDWMEQEQERG
ITITSAATTAFWSGMSKQYPQHRINVIDTPGHVDFTIEVERSMRVLDGAVMVYCAVGGVQ
PQSETVWRQANKYQVPRVAFVNKMDRTGANFLRVVEQIKTRLGGNSVPLQLPIGSEDNFK
GVVDLVKMKAINWNEADQGMTFTYEEIPADMVDACEEWRQNLVESAAEASEELMEKYLGG
EELTEEEIKAGLRQRVLAGEIIPVCCGSAFKNKGVQAMLDAVIDYLPAPTDIPAIKGINP
DETEGERHASDDEPFSALAFKIATDPFVGNLTFFRVYSGVINSGDTVLNSVKDKRERFGR
IVQMHANKREEIKEVRAGDIAAAIGLKDVGTGDTLCAQDAPIILERMEFPEPVISVAVEP
KTKADQEKMGLALGRLAQEDPSFRVHTDEESGETIISGMGELHLDIIVDRMRREFKVEAN
IGKPQVSYRETIRTRVNDVEGKHAKQSGGRGQYGHVVIDLYPLDPEGPGYEFVNEIKGGV
IPGEYIPAVDKGVQEQLKSGPLAGYPVVDLGVRLHFGSYHDVDSSELAFKLAASLAFKAA
FNKANPVLLEPIMKVEVETPPDYVGDVIGDLSRRRAMVNGQEANEFVVKINAEVPLSEMF
GYATDLRSQTQGRASYSMEPLKYAEAPKNVADAIIEARKK
Download sequence
Identical sequences A0A1E3XLB3 A0A2K2YL66 P57938 V4MSN6
WP_005717860.1.11014 WP_005717860.1.11214 WP_005717860.1.11947 WP_005717860.1.12156 WP_005717860.1.12311 WP_005717860.1.14908 WP_005717860.1.15732 WP_005717860.1.17980 WP_005717860.1.19996 WP_005717860.1.21657 WP_005717860.1.23830 WP_005717860.1.24757 WP_005717860.1.26777 WP_005717860.1.27416 WP_005717860.1.27592 WP_005717860.1.27664 WP_005717860.1.28084 WP_005717860.1.35562 WP_005717860.1.36022 WP_005717860.1.3807 WP_005717860.1.38246 WP_005717860.1.3839 WP_005717860.1.3957 WP_005717860.1.40210 WP_005717860.1.40787 WP_005717860.1.41297 WP_005717860.1.41351 WP_005717860.1.41657 WP_005717860.1.41667 WP_005717860.1.4211 WP_005717860.1.42469 WP_005717860.1.42512 WP_005717860.1.43687 WP_005717860.1.45422 WP_005717860.1.4808 WP_005717860.1.49053 WP_005717860.1.51342 WP_005717860.1.52585 WP_005717860.1.52859 WP_005717860.1.53852 WP_005717860.1.55074 WP_005717860.1.55401 WP_005717860.1.57956 WP_005717860.1.58111 WP_005717860.1.60478 WP_005717860.1.61098 WP_005717860.1.6219 WP_005717860.1.62389 WP_005717860.1.6332 WP_005717860.1.63549 WP_005717860.1.66990 WP_005717860.1.72215 WP_005717860.1.74955 WP_005717860.1.75804 WP_005717860.1.78987 WP_005717860.1.79347 WP_005717860.1.79593 WP_005717860.1.81885 WP_005717860.1.8281 WP_005717860.1.83579 WP_005717860.1.88402 WP_005717860.1.89773 WP_005717860.1.90578 WP_005717860.1.92478 WP_005717860.1.93940 WP_005717860.1.94432 WP_005717860.1.95718 WP_005717860.1.9746 WP_005717860.1.9947 272843.PM1356 gi|386835635|ref|YP_006240955.1| gi|383311611|ref|YP_005364421.1| gi|15603221|ref|NP_246295.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]