SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603225|ref|NP_246299.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603225|ref|NP_246299.1|
Domain Number 1 Region: 1-313
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.85e-50
Family Tyrosine-dependent oxidoreductases 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603225|ref|NP_246299.1|
Sequence length 315
Comment hypothetical protein PM1360 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKIIITGGQGFLGQRLAKTLLSHPHVQVDELILIDVIKPIAPNHDPRVRCIEMDLRQPEG
LDEIIDQQTDAIFHLAAIVSSHAEQDPDLGYEINFLATRHLLECCRHRNPKIRFIFTSSL
AVYGGKLPDVIEDHTAVTPQSTYGTQKAMCELLINDYSRKGFVDGIVLRLPTICIRPGKP
NKAASSFVSSIIREPLHNEMAICPVSVQLKLWLSSPNTVVNNFIHALQLPSLPARDWHVI
NLPGFTVTVENMLSELAKVKGDAILQYVNVAFDEGINNIVASWPAAINCSHALGLGFHAD
QRFADVIQQFIQYDM
Download sequence
Identical sequences Q9CL82
WP_010907139.1.12311 WP_010907139.1.15732 WP_010907139.1.19996 WP_010907139.1.21657 WP_010907139.1.40210 WP_010907139.1.45422 WP_010907139.1.4808 WP_010907139.1.51342 WP_010907139.1.53852 WP_010907139.1.6219 WP_010907139.1.62389 WP_010907139.1.66990 WP_010907139.1.81885 WP_010907139.1.8281 WP_010907139.1.89773 WP_010907139.1.9746 WP_010907139.1.9947 gi|15603225|ref|NP_246299.1| 272843.PM1360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]