SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603227|ref|NP_246301.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603227|ref|NP_246301.1|
Domain Number 1 Region: 6-222
Classification Level Classification E-value
Superfamily Putative cyclase 1.96e-38
Family Putative cyclase 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603227|ref|NP_246301.1|
Sequence length 224
Comment hypothetical protein PM1362 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNYQLLSYPLDIKDPGFPGEPTLTFESSTSIAEGDVYNSAIIHLFNHFGTHFDAPKHFNP
NGLSISELPLSTFIYEKPLLVDIPKAPGTLIEPEDLAPYLTQMQQADSLFIRTGLEQLRQ
TDPQQYAANGGAVSIQAAKYLIDHASHLKAIGFDFISLASPANPEHGVEAHQVMLGMYKP
AFICIIEDMKLSQVNSETLMRVLAMPLLVKGIDSAQVTVLAEER
Download sequence
Identical sequences A0A1D7R5V2 A0A2K2YWN2 Q9CL80 V4NHM4
gi|15603227|ref|NP_246301.1| gi|378775192|ref|YP_005177435.1| gi|386835208|ref|YP_006240525.1| 272843.PM1362 WP_005723974.1.10027 WP_005723974.1.10721 WP_005723974.1.11014 WP_005723974.1.12311 WP_005723974.1.1307 WP_005723974.1.14908 WP_005723974.1.15732 WP_005723974.1.17217 WP_005723974.1.17980 WP_005723974.1.18123 WP_005723974.1.19996 WP_005723974.1.20287 WP_005723974.1.21657 WP_005723974.1.22153 WP_005723974.1.2313 WP_005723974.1.23830 WP_005723974.1.26616 WP_005723974.1.27416 WP_005723974.1.27592 WP_005723974.1.27664 WP_005723974.1.29697 WP_005723974.1.30617 WP_005723974.1.34253 WP_005723974.1.35978 WP_005723974.1.36022 WP_005723974.1.39152 WP_005723974.1.3957 WP_005723974.1.40210 WP_005723974.1.41351 WP_005723974.1.41462 WP_005723974.1.41657 WP_005723974.1.41667 WP_005723974.1.42469 WP_005723974.1.42512 WP_005723974.1.42943 WP_005723974.1.44741 WP_005723974.1.45422 WP_005723974.1.47685 WP_005723974.1.4808 WP_005723974.1.50853 WP_005723974.1.51342 WP_005723974.1.52066 WP_005723974.1.53852 WP_005723974.1.55074 WP_005723974.1.57420 WP_005723974.1.58111 WP_005723974.1.58450 WP_005723974.1.58628 WP_005723974.1.58910 WP_005723974.1.59455 WP_005723974.1.60664 WP_005723974.1.61098 WP_005723974.1.61860 WP_005723974.1.62016 WP_005723974.1.6219 WP_005723974.1.62389 WP_005723974.1.65482 WP_005723974.1.65878 WP_005723974.1.66934 WP_005723974.1.66990 WP_005723974.1.70689 WP_005723974.1.73917 WP_005723974.1.74955 WP_005723974.1.75804 WP_005723974.1.79593 WP_005723974.1.80223 WP_005723974.1.80589 WP_005723974.1.80911 WP_005723974.1.81885 WP_005723974.1.8281 WP_005723974.1.86541 WP_005723974.1.87897 WP_005723974.1.88402 WP_005723974.1.89773 WP_005723974.1.90081 WP_005723974.1.90179 WP_005723974.1.90578 WP_005723974.1.91495 WP_005723974.1.92478 WP_005723974.1.93940 WP_005723974.1.94432 WP_005723974.1.94435 WP_005723974.1.95718 WP_005723974.1.9746 WP_005723974.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]