SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603231|ref|NP_246305.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603231|ref|NP_246305.1|
Domain Number 1 Region: 168-292
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.47e-36
Family Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain 0.00091
Further Details:      
 
Domain Number 2 Region: 6-167
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.91e-33
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603231|ref|NP_246305.1|
Sequence length 301
Comment hypothetical protein PM1366 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNQNISVAVIGLGAMGMGAAQSCIRAGLTTYGADLNPLALEKLKAEGAKGVSQSAVDFAQ
ELDAVLLLVVNASQVNTVLFGEKGLASHLKPGTAVMVSSTISAQDAQQISQKLTGLGLVM
LDAPVSGGAAKAAAGEMTVMASGSQQAFTKLQPVLDAVAGKVYNIGEEIGLGATVKIIHQ
LLAGVHIAAGAEAMALAARAGIPLDLMYDVVTHAAGNSWMFENRMKHVVEGDYTPLSMVD
IFVKDLGLVTDTAKALKFPLPLASTAFNMFTSASNAGYGKEDDSAVIKIFSGIELPQKKG
A
Download sequence
Identical sequences A0A2J9QWS2 Q9CL76
gi|15603231|ref|NP_246305.1| 272843.PM1366 WP_010907143.1.12311 WP_010907143.1.15732 WP_010907143.1.19996 WP_010907143.1.26777 WP_010907143.1.36022 WP_010907143.1.40210 WP_010907143.1.45422 WP_010907143.1.4808 WP_010907143.1.53852 WP_010907143.1.6219 WP_010907143.1.62389 WP_010907143.1.66990 WP_010907143.1.81885 WP_010907143.1.8281 WP_010907143.1.89773 WP_010907143.1.95718 WP_010907143.1.9746 WP_010907143.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]