SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603235|ref|NP_246309.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603235|ref|NP_246309.1|
Domain Number 1 Region: 10-237,406-477
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.18e-105
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00066
Further Details:      
 
Domain Number 2 Region: 463-569
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.87e-33
Family Anticodon-binding domain of Class II aaRS 0.00089
Further Details:      
 
Domain Number 3 Region: 218-389
Classification Level Classification E-value
Superfamily YbaK/ProRS associated domain 1.03e-30
Family YbaK/ProRS associated domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603235|ref|NP_246309.1|
Sequence length 571
Comment prolyl-tRNA synthetase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MRTSQYLFSTLKETPAEASIVSHQLMLRAGMIRPLASGLYTWLPTGLRVLNKVEKIIREE
MDKSGALEVKMAVTQPAELWQESGRWEEYGPELLRFKDRGERDFVIGPTNEEVITDLVRR
ELSSYKQLPLNLYHIQTKFRDEVRPRFGVMRSREFVMKDAYSFHTTHECLQKTYDVMYET
YSNIFNRLGLDFRAVQADTGSIGGSASHEFQVLAQSGEDDVVFSTESDFAANIELAEAVA
LGERGAATEELRVVDTPNAKTIAELVEQFNQPIEKTVKTLVVHATEESGHKLVALLVRGD
HELNEIKAEKVDIVASPLQFATDEEIRAVVGAGTGSLGPINLPMPIVIDRTVANMDNFSA
GANQDGKHYFGINWERDLPVPHIADLRNVVEGDPSPDGKGVLQIKRGIEVGHIFQLGTKY
SAAMNATVQGEDGRPQTMIMGCYGIGVTRVIAAAIEQHHDERGIIWPDNIAPFKVAIVPM
NMHKSESVQQFAEELYRTLTAQGVEVIFDDRKERPGVMFADMELIGVPHMIVIGEKNLEK
GEIEYKYRRSGEKEMIAKDQLLDVLKAKFAS
Download sequence
Identical sequences A0A290LLJ3 Q9CL72
gi|15603235|ref|NP_246309.1| 272843.PM1370 WP_005723980.1.12311 WP_005723980.1.15732 WP_005723980.1.19996 WP_005723980.1.40210 WP_005723980.1.41351 WP_005723980.1.41667 WP_005723980.1.45422 WP_005723980.1.4808 WP_005723980.1.53852 WP_005723980.1.58111 WP_005723980.1.6219 WP_005723980.1.62389 WP_005723980.1.66990 WP_005723980.1.70689 WP_005723980.1.81885 WP_005723980.1.8281 WP_005723980.1.88402 WP_005723980.1.89773 WP_005723980.1.92478 WP_005723980.1.93940 WP_005723980.1.9746 WP_005723980.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]