SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603241|ref|NP_246315.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603241|ref|NP_246315.1|
Domain Number 1 Region: 4-131
Classification Level Classification E-value
Superfamily CheY-like 4.13e-35
Family CheY-related 0.00034
Further Details:      
 
Domain Number 2 Region: 136-237
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.56e-25
Family PhoB-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603241|ref|NP_246315.1|
Sequence length 243
Comment hypothetical protein PM1376 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MDIQMQQNTSLLVIDDDVQVCELLTDIFEEHGYTVMTAQTGQQALALLQSTPHFSLIFLD
LILPDVNGLILLQRLKSLTTAPVIMLSGLDSESDIVVGLEMGADDYISKPFYPRVVVARA
KVALRRHQPQPFSTSASHQGFTFHHWVLDTQNRKLYSPQKVDIELTQGEYTLLHALVSHA
QKVLSREKLLELTHTESLEIFDRTVDVLIMRLRKKIEPNPKAPTYIQTVRGMGYLFAVAV
ERC
Download sequence
Identical sequences Q9CL66 V4Q0T8
272843.PM1376 gi|15603241|ref|NP_246315.1| gi|378775223|ref|YP_005177466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]