SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603242|ref|NP_246316.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603242|ref|NP_246316.1|
Domain Number 1 Region: 6-303
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.08e-79
Family L-arabinose binding protein-like 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603242|ref|NP_246316.1|
Sequence length 309
Comment hypothetical protein PM1377 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKLKTLAVSLMLAMAPFAQAKELKSIGVTVGDLANPFFVQIAKGAELKAKELAGDKVNVV
SVSSGYDLGQQVAQIDNFIAAKTDMIILNAADSKGIGPAVERARKAGIVVVAVDVAADGA
DATVTSNNYQAGEIACQTIVEKLNGKGNVVIINGPPVSAVQDRVQGCQDVFAKHADIKVL
SHNQNAKGSREGGLEVMTSLLIAHPKIDAVFAINDPTAIGADLAAKQAQRNEFFIMGVDG
SPDGEEALKLSDSLFRGTPAQDPQVMAAEAVKIGYDILQGKPAPKDPVLIPVHLITRDNI
KDYKGWTVK
Download sequence
Identical sequences A0A1D7R5J1 J6CLS9 Q9CL65 V4MTM4
gi|15603242|ref|NP_246316.1| 272843.PM1377 WP_005723986.1.10027 WP_005723986.1.10721 WP_005723986.1.11014 WP_005723986.1.11214 WP_005723986.1.11947 WP_005723986.1.12156 WP_005723986.1.12311 WP_005723986.1.1307 WP_005723986.1.14908 WP_005723986.1.15732 WP_005723986.1.17217 WP_005723986.1.17980 WP_005723986.1.18123 WP_005723986.1.19996 WP_005723986.1.20287 WP_005723986.1.22153 WP_005723986.1.2313 WP_005723986.1.23830 WP_005723986.1.24757 WP_005723986.1.26616 WP_005723986.1.26777 WP_005723986.1.27416 WP_005723986.1.28084 WP_005723986.1.29697 WP_005723986.1.30617 WP_005723986.1.34253 WP_005723986.1.35562 WP_005723986.1.35978 WP_005723986.1.36022 WP_005723986.1.3807 WP_005723986.1.38246 WP_005723986.1.3839 WP_005723986.1.39152 WP_005723986.1.3957 WP_005723986.1.40210 WP_005723986.1.40787 WP_005723986.1.41297 WP_005723986.1.41351 WP_005723986.1.41462 WP_005723986.1.41657 WP_005723986.1.41667 WP_005723986.1.4211 WP_005723986.1.42469 WP_005723986.1.42512 WP_005723986.1.42943 WP_005723986.1.43687 WP_005723986.1.44741 WP_005723986.1.45422 WP_005723986.1.47685 WP_005723986.1.4808 WP_005723986.1.49053 WP_005723986.1.52066 WP_005723986.1.52585 WP_005723986.1.52859 WP_005723986.1.53852 WP_005723986.1.55074 WP_005723986.1.55401 WP_005723986.1.57420 WP_005723986.1.57956 WP_005723986.1.58111 WP_005723986.1.58257 WP_005723986.1.58450 WP_005723986.1.58628 WP_005723986.1.58910 WP_005723986.1.59455 WP_005723986.1.60478 WP_005723986.1.60664 WP_005723986.1.61098 WP_005723986.1.61860 WP_005723986.1.62016 WP_005723986.1.6219 WP_005723986.1.62389 WP_005723986.1.6332 WP_005723986.1.63549 WP_005723986.1.65482 WP_005723986.1.65878 WP_005723986.1.66934 WP_005723986.1.66990 WP_005723986.1.70689 WP_005723986.1.72215 WP_005723986.1.73917 WP_005723986.1.74955 WP_005723986.1.75804 WP_005723986.1.78987 WP_005723986.1.79347 WP_005723986.1.79593 WP_005723986.1.80223 WP_005723986.1.80589 WP_005723986.1.80911 WP_005723986.1.81885 WP_005723986.1.8281 WP_005723986.1.83579 WP_005723986.1.86541 WP_005723986.1.87897 WP_005723986.1.88402 WP_005723986.1.89773 WP_005723986.1.90081 WP_005723986.1.90179 WP_005723986.1.90578 WP_005723986.1.91495 WP_005723986.1.92478 WP_005723986.1.93940 WP_005723986.1.94432 WP_005723986.1.94435 WP_005723986.1.95718 WP_005723986.1.9746 gi|386835241|ref|YP_006240558.1| gi|378775224|ref|YP_005177467.1| gi|383311223|ref|YP_005364033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]