SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603260|ref|NP_246334.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603260|ref|NP_246334.1|
Domain Number 1 Region: 15-422
Classification Level Classification E-value
Superfamily Preprotein translocase SecY subunit 1.26e-134
Family Preprotein translocase SecY subunit 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603260|ref|NP_246334.1|
Sequence length 441
Comment preprotein translocase subunit SecY [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAKQPGYQSRSTQSGTGELKSRLLFVLGALIVFRIGSFIPVPGIDAAVLAQLVEQQKGTI
IDMFNMFSGGALSRASIFALGIMPYISASIIIQLLTTVHPALAELKKEGEAGRRKISKYT
RYSTLVLATLQAVGISTGLPNMLPGLVPNVGFSFYLAAVISLVTGTMFLMWLGEQITERG
IGNGISLIIFAGIVAGLPSAIGQTIEQTRQGQMHLLVLLLIAVIVFAVTYFVVFVERGQR
RIKVEYAKRQQGRQILGGHSTHLPLKVNMAGVIPAIFASSIILFPATLAQWLGEGSSLEW
LTDLSMLLHPGQPLYLLVYAVAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQT
SRYIDKIMTRLTLIGGLYITFVCLVPYVMTSAWNVQFYFGGTSLLIVVVVIMDFIAQVQS
HLMSTKYESALKKANLKGFGQ
Download sequence
Identical sequences Q9CL50
gi|15603260|ref|NP_246334.1| 272843.PM1395 WP_010907153.1.12311 WP_010907153.1.15732 WP_010907153.1.19996 WP_010907153.1.40210 WP_010907153.1.45422 WP_010907153.1.4808 WP_010907153.1.53852 WP_010907153.1.6219 WP_010907153.1.62389 WP_010907153.1.66990 WP_010907153.1.81885 WP_010907153.1.8281 WP_010907153.1.89773 WP_010907153.1.9746 WP_010907153.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]