SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603263|ref|NP_246337.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603263|ref|NP_246337.1|
Domain Number 1 Region: 79-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-27
Family Translational machinery components 0.0000193
Further Details:      
 
Domain Number 2 Region: 9-75
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.07e-24
Family Ribosomal S5 protein, N-terminal domain 0.0000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603263|ref|NP_246337.1|
Sequence length 166
Comment 30S ribosomal protein S5 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MANIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAI
QKAMEKARRNMINVALNEGTLQHPIKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGV
RNVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVDEILG
Download sequence
Identical sequences A0A1E3XIH8 A0A2K2YUT4 Q9CL47 V4Q0R4
gi|378775247|ref|YP_005177490.1| WP_005717915.1.10027 WP_005717915.1.10721 WP_005717915.1.11014 WP_005717915.1.11214 WP_005717915.1.11947 WP_005717915.1.12156 WP_005717915.1.12311 WP_005717915.1.1307 WP_005717915.1.14908 WP_005717915.1.15732 WP_005717915.1.17217 WP_005717915.1.17980 WP_005717915.1.18123 WP_005717915.1.19996 WP_005717915.1.20287 WP_005717915.1.22153 WP_005717915.1.2313 WP_005717915.1.23830 WP_005717915.1.24757 WP_005717915.1.26616 WP_005717915.1.26777 WP_005717915.1.27416 WP_005717915.1.27592 WP_005717915.1.27664 WP_005717915.1.28084 WP_005717915.1.29697 WP_005717915.1.30617 WP_005717915.1.34253 WP_005717915.1.35562 WP_005717915.1.35978 WP_005717915.1.36022 WP_005717915.1.3807 WP_005717915.1.38246 WP_005717915.1.3839 WP_005717915.1.39152 WP_005717915.1.3957 WP_005717915.1.40210 WP_005717915.1.40787 WP_005717915.1.41297 WP_005717915.1.41351 WP_005717915.1.41462 WP_005717915.1.41657 WP_005717915.1.41667 WP_005717915.1.4211 WP_005717915.1.42469 WP_005717915.1.42512 WP_005717915.1.42943 WP_005717915.1.43687 WP_005717915.1.44741 WP_005717915.1.45422 WP_005717915.1.47685 WP_005717915.1.4808 WP_005717915.1.49053 WP_005717915.1.50853 WP_005717915.1.52066 WP_005717915.1.52585 WP_005717915.1.52859 WP_005717915.1.53852 WP_005717915.1.55074 WP_005717915.1.55401 WP_005717915.1.57420 WP_005717915.1.57956 WP_005717915.1.58111 WP_005717915.1.58257 WP_005717915.1.58450 WP_005717915.1.58628 WP_005717915.1.58910 WP_005717915.1.59455 WP_005717915.1.60478 WP_005717915.1.60664 WP_005717915.1.61098 WP_005717915.1.61860 WP_005717915.1.62016 WP_005717915.1.6219 WP_005717915.1.62389 WP_005717915.1.6332 WP_005717915.1.63549 WP_005717915.1.65482 WP_005717915.1.65878 WP_005717915.1.66934 WP_005717915.1.66990 WP_005717915.1.70689 WP_005717915.1.72215 WP_005717915.1.73917 WP_005717915.1.74955 WP_005717915.1.75804 WP_005717915.1.78987 WP_005717915.1.79347 WP_005717915.1.79593 WP_005717915.1.80223 WP_005717915.1.80589 WP_005717915.1.80911 WP_005717915.1.81885 WP_005717915.1.8281 WP_005717915.1.83579 WP_005717915.1.86541 WP_005717915.1.87897 WP_005717915.1.88402 WP_005717915.1.89773 WP_005717915.1.90081 WP_005717915.1.90179 WP_005717915.1.90578 WP_005717915.1.91495 WP_005717915.1.92478 WP_005717915.1.93940 WP_005717915.1.94432 WP_005717915.1.94435 WP_005717915.1.95718 WP_005717915.1.9746 WP_005717915.1.9947 272843.PM1398 gi|386835263|ref|YP_006240580.1| gi|15603263|ref|NP_246337.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]