SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603270|ref|NP_246344.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603270|ref|NP_246344.1|
Domain Number 1 Region: 2-122
Classification Level Classification E-value
Superfamily Ribosomal protein L14 6.8e-51
Family Ribosomal protein L14 0.000000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603270|ref|NP_246344.1|
Sequence length 123
Comment 50S ribosomal protein L14 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKITVKEAIPRGKVKKGDVLKA
VVVRTKKGVRRPDGSVIRFDGNACVILNNNTEQPIGTRIFGPVTRELRSEKFMKIISLAP
EVL
Download sequence
Identical sequences A0A0D0IIR1 A0A0E1SQQ7 A0A0E1WML4 A0A0E3ZQY5 A0A0H3PFA1 A0A0M1GMT6 A0A0M3G9C9 A0A0Y0B5N5 A0A193GNP5 A0A1B3JFQ5 A0A1B8QSV0 A0A1E3XKK5 A0A1T0B582 A0A1V3IKJ5 A0A1V3JHA7 A0A1V3JQE4 A0A1V3JYW5 A0A1V3KCH3 A0A1V3KU31 A0A1V3LBM8 A0A265QFB1 A0A2K2YUT7 A4MWT5 A4N328 A4NX95 A5UDT7 A5UHU1 A6VLJ8 C9PSM3 E1XB91 E6KVE0 E7A6B2 F2C078 F9GRF0 F9GVX7 F9GXC3 F9H4H9 G4A6Q9 H0KGG4 H1LQC5 J6CLL6 P66067 P66068 Q4QMB1 V4N9Q5
gi|319775278|ref|YP_004137766.1| gi|152978151|ref|YP_001343780.1| gi|365967003|ref|YP_004948565.1| gi|386835270|ref|YP_006240587.1| gi|387120544|ref|YP_006286427.1| NP_438947.1.63031 WP_005548786.1.10027 WP_005548786.1.101095 WP_005548786.1.101344 WP_005548786.1.101347 WP_005548786.1.101989 WP_005548786.1.1036 WP_005548786.1.10534 WP_005548786.1.10621 WP_005548786.1.10721 WP_005548786.1.11014 WP_005548786.1.11214 WP_005548786.1.1191 WP_005548786.1.11947 WP_005548786.1.12069 WP_005548786.1.12156 WP_005548786.1.12311 WP_005548786.1.12329 WP_005548786.1.12387 WP_005548786.1.12713 WP_005548786.1.1307 WP_005548786.1.13356 WP_005548786.1.13610 WP_005548786.1.14659 WP_005548786.1.14777 WP_005548786.1.14908 WP_005548786.1.15261 WP_005548786.1.15732 WP_005548786.1.15927 WP_005548786.1.16246 WP_005548786.1.16857 WP_005548786.1.17173 WP_005548786.1.17217 WP_005548786.1.17253 WP_005548786.1.17428 WP_005548786.1.17459 WP_005548786.1.176 WP_005548786.1.17980 WP_005548786.1.18037 WP_005548786.1.18123 WP_005548786.1.18228 WP_005548786.1.19990 WP_005548786.1.19996 WP_005548786.1.20018 WP_005548786.1.20073 WP_005548786.1.20287 WP_005548786.1.20644 WP_005548786.1.20853 WP_005548786.1.20949 WP_005548786.1.21657 WP_005548786.1.22041 WP_005548786.1.22153 WP_005548786.1.23065 WP_005548786.1.2313 WP_005548786.1.23149 WP_005548786.1.23830 WP_005548786.1.23920 WP_005548786.1.24063 WP_005548786.1.24757 WP_005548786.1.25285 WP_005548786.1.25413 WP_005548786.1.25656 WP_005548786.1.26077 WP_005548786.1.26148 WP_005548786.1.26388 WP_005548786.1.26616 WP_005548786.1.26667 WP_005548786.1.26774 WP_005548786.1.26777 WP_005548786.1.27416 WP_005548786.1.27592 WP_005548786.1.27664 WP_005548786.1.27712 WP_005548786.1.28084 WP_005548786.1.28339 WP_005548786.1.28397 WP_005548786.1.28719 WP_005548786.1.29002 WP_005548786.1.29697 WP_005548786.1.29741 WP_005548786.1.30617 WP_005548786.1.32414 WP_005548786.1.32618 WP_005548786.1.32982 WP_005548786.1.34253 WP_005548786.1.34722 WP_005548786.1.34925 WP_005548786.1.35562 WP_005548786.1.35978 WP_005548786.1.36022 WP_005548786.1.36515 WP_005548786.1.37003 WP_005548786.1.3733 WP_005548786.1.37452 WP_005548786.1.3807 WP_005548786.1.38246 WP_005548786.1.3839 WP_005548786.1.38460 WP_005548786.1.38938 WP_005548786.1.38951 WP_005548786.1.39152 WP_005548786.1.39279 WP_005548786.1.3957 WP_005548786.1.39974 WP_005548786.1.40038 WP_005548786.1.40040 WP_005548786.1.40210 WP_005548786.1.40343 WP_005548786.1.40503 WP_005548786.1.40787 WP_005548786.1.40888 WP_005548786.1.40942 WP_005548786.1.41297 WP_005548786.1.41351 WP_005548786.1.41462 WP_005548786.1.41611 WP_005548786.1.41657 WP_005548786.1.41667 WP_005548786.1.4211 WP_005548786.1.42240 WP_005548786.1.42267 WP_005548786.1.42390 WP_005548786.1.42469 WP_005548786.1.42512 WP_005548786.1.42729 WP_005548786.1.42821 WP_005548786.1.42943 WP_005548786.1.43038 WP_005548786.1.43486 WP_005548786.1.43687 WP_005548786.1.43923 WP_005548786.1.44741 WP_005548786.1.44773 WP_005548786.1.44893 WP_005548786.1.45125 WP_005548786.1.45422 WP_005548786.1.4569 WP_005548786.1.45932 WP_005548786.1.46862 WP_005548786.1.47625 WP_005548786.1.47685 WP_005548786.1.47920 WP_005548786.1.4808 WP_005548786.1.48995 WP_005548786.1.49053 WP_005548786.1.50252 WP_005548786.1.50507 WP_005548786.1.50588 WP_005548786.1.50795 WP_005548786.1.50853 WP_005548786.1.51342 WP_005548786.1.51509 WP_005548786.1.51904 WP_005548786.1.51941 WP_005548786.1.52066 WP_005548786.1.52585 WP_005548786.1.52701 WP_005548786.1.52859 WP_005548786.1.53457 WP_005548786.1.53852 WP_005548786.1.5387 WP_005548786.1.53947 WP_005548786.1.54151 WP_005548786.1.54653 WP_005548786.1.54661 WP_005548786.1.54891 WP_005548786.1.55069 WP_005548786.1.55074 WP_005548786.1.55170 WP_005548786.1.55401 WP_005548786.1.56005 WP_005548786.1.56181 WP_005548786.1.57183 WP_005548786.1.57312 WP_005548786.1.57420 WP_005548786.1.57639 WP_005548786.1.57956 WP_005548786.1.58111 WP_005548786.1.58257 WP_005548786.1.58450 WP_005548786.1.58628 WP_005548786.1.58856 WP_005548786.1.58910 WP_005548786.1.58968 WP_005548786.1.59051 WP_005548786.1.59352 WP_005548786.1.59455 WP_005548786.1.59529 WP_005548786.1.59686 WP_005548786.1.60478 WP_005548786.1.6054 WP_005548786.1.60664 WP_005548786.1.61098 WP_005548786.1.61426 WP_005548786.1.61634 WP_005548786.1.61635 WP_005548786.1.61860 WP_005548786.1.62016 WP_005548786.1.62109 WP_005548786.1.6219 WP_005548786.1.62389 WP_005548786.1.62697 WP_005548786.1.63012 WP_005548786.1.63179 WP_005548786.1.63263 WP_005548786.1.6332 WP_005548786.1.6349 WP_005548786.1.63539 WP_005548786.1.63549 WP_005548786.1.63658 WP_005548786.1.64134 WP_005548786.1.64647 WP_005548786.1.64927 WP_005548786.1.65165 WP_005548786.1.65482 WP_005548786.1.65878 WP_005548786.1.66934 WP_005548786.1.66990 WP_005548786.1.67509 WP_005548786.1.68230 WP_005548786.1.68713 WP_005548786.1.68965 WP_005548786.1.69356 WP_005548786.1.69783 WP_005548786.1.70689 WP_005548786.1.712 WP_005548786.1.71424 WP_005548786.1.71865 WP_005548786.1.72215 WP_005548786.1.72517 WP_005548786.1.73917 WP_005548786.1.74023 WP_005548786.1.74240 WP_005548786.1.74265 WP_005548786.1.74810 WP_005548786.1.74955 WP_005548786.1.75193 WP_005548786.1.75514 WP_005548786.1.75525 WP_005548786.1.75804 WP_005548786.1.76348 WP_005548786.1.76369 WP_005548786.1.76410 WP_005548786.1.76422 WP_005548786.1.76737 WP_005548786.1.78014 WP_005548786.1.78836 WP_005548786.1.78987 WP_005548786.1.79232 WP_005548786.1.79255 WP_005548786.1.79347 WP_005548786.1.79564 WP_005548786.1.79593 WP_005548786.1.79681 WP_005548786.1.79785 WP_005548786.1.80223 WP_005548786.1.80589 WP_005548786.1.80605 WP_005548786.1.80617 WP_005548786.1.80911 WP_005548786.1.81823 WP_005548786.1.81864 WP_005548786.1.81885 WP_005548786.1.82376 WP_005548786.1.82381 WP_005548786.1.82426 WP_005548786.1.8281 WP_005548786.1.83579 WP_005548786.1.83625 WP_005548786.1.85244 WP_005548786.1.85362 WP_005548786.1.8570 WP_005548786.1.86352 WP_005548786.1.8638 WP_005548786.1.86541 WP_005548786.1.86544 WP_005548786.1.86649 WP_005548786.1.87239 WP_005548786.1.87366 WP_005548786.1.87894 WP_005548786.1.87897 WP_005548786.1.8829 WP_005548786.1.88402 WP_005548786.1.88810 WP_005548786.1.89549 WP_005548786.1.89773 WP_005548786.1.90081 WP_005548786.1.90179 WP_005548786.1.90238 WP_005548786.1.90320 WP_005548786.1.90379 WP_005548786.1.90578 WP_005548786.1.90586 WP_005548786.1.91188 WP_005548786.1.91495 WP_005548786.1.91584 WP_005548786.1.91647 WP_005548786.1.91688 WP_005548786.1.91769 WP_005548786.1.92138 WP_005548786.1.92478 WP_005548786.1.92519 WP_005548786.1.92858 WP_005548786.1.93392 WP_005548786.1.93723 WP_005548786.1.93908 WP_005548786.1.93940 WP_005548786.1.94112 WP_005548786.1.94432 WP_005548786.1.94435 WP_005548786.1.94547 WP_005548786.1.94621 WP_005548786.1.94624 WP_005548786.1.95718 WP_005548786.1.95794 WP_005548786.1.9601 WP_005548786.1.96095 WP_005548786.1.96396 WP_005548786.1.96546 WP_005548786.1.9694 WP_005548786.1.9746 WP_005548786.1.9761 WP_005548786.1.97721 WP_005548786.1.97818 WP_005548786.1.98200 WP_005548786.1.98423 WP_005548786.1.99240 WP_005548786.1.99326 WP_005548786.1.9947 WP_005548786.1.99776 gi|342243405|ref|YP_004770517.1| gi|148826568|ref|YP_001291321.1| 272843.PM1405 281310.NTHI0951 339671.Asuc_0469 374930.CGSHiEE_08125 374931.CGSHiGG_07440 71421.HI0788 gi|386266485|ref|YP_005829977.1| gi|15603270|ref|NP_246344.1| gi|543951524|ref|YP_008543598.1| gi|386264773|ref|YP_005828266.1| gi|148827977|ref|YP_001292730.1| gi|319897718|ref|YP_004135915.1| gi|378696988|ref|YP_005178946.1| gi|378775254|ref|YP_005177497.1| gi|383311251|ref|YP_005364061.1| gi|16272729|ref|NP_438947.1| gi|68249384|ref|YP_248496.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]