SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603273|ref|NP_246347.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603273|ref|NP_246347.1|
Domain Number 1 Region: 3-133
Classification Level Classification E-value
Superfamily Ribosomal protein L16p/L10e 2.09e-54
Family Ribosomal protein L16p 0.000000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603273|ref|NP_246347.1|
Sequence length 136
Comment 50S ribosomal protein L16 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLQPKRTKFRKVHKGRNRGIAAGTEVSFGTFGLKAVGRGRLTARQIEAARRAMTRAVKRQ
GKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVSEEIARNAFALA
AAKLPIKTTFVTKTVM
Download sequence
Identical sequences A0A0E3ZPL1 A0A1E3XIG5 A0A2K2YUU2 C9PSM6 Q9CL38 V4Q0Q4
WP_005717925.1.10027 WP_005717925.1.10721 WP_005717925.1.11014 WP_005717925.1.11214 WP_005717925.1.11947 WP_005717925.1.12156 WP_005717925.1.12311 WP_005717925.1.1307 WP_005717925.1.14908 WP_005717925.1.15732 WP_005717925.1.17217 WP_005717925.1.17980 WP_005717925.1.18123 WP_005717925.1.19996 WP_005717925.1.20287 WP_005717925.1.21657 WP_005717925.1.22153 WP_005717925.1.2313 WP_005717925.1.23830 WP_005717925.1.24757 WP_005717925.1.26616 WP_005717925.1.26777 WP_005717925.1.27416 WP_005717925.1.27592 WP_005717925.1.27664 WP_005717925.1.28084 WP_005717925.1.29202 WP_005717925.1.29697 WP_005717925.1.30617 WP_005717925.1.34253 WP_005717925.1.35562 WP_005717925.1.35978 WP_005717925.1.36022 WP_005717925.1.3807 WP_005717925.1.38246 WP_005717925.1.3839 WP_005717925.1.39152 WP_005717925.1.3957 WP_005717925.1.40210 WP_005717925.1.40787 WP_005717925.1.41297 WP_005717925.1.41351 WP_005717925.1.41462 WP_005717925.1.41657 WP_005717925.1.41667 WP_005717925.1.4211 WP_005717925.1.42469 WP_005717925.1.42512 WP_005717925.1.42943 WP_005717925.1.43687 WP_005717925.1.44741 WP_005717925.1.45422 WP_005717925.1.47685 WP_005717925.1.4808 WP_005717925.1.49053 WP_005717925.1.50853 WP_005717925.1.51342 WP_005717925.1.52066 WP_005717925.1.52585 WP_005717925.1.52859 WP_005717925.1.53852 WP_005717925.1.55074 WP_005717925.1.55401 WP_005717925.1.57420 WP_005717925.1.57956 WP_005717925.1.58111 WP_005717925.1.58257 WP_005717925.1.58450 WP_005717925.1.58628 WP_005717925.1.58910 WP_005717925.1.58968 WP_005717925.1.59455 WP_005717925.1.60478 WP_005717925.1.60664 WP_005717925.1.61098 WP_005717925.1.61860 WP_005717925.1.62016 WP_005717925.1.6219 WP_005717925.1.62389 WP_005717925.1.6332 WP_005717925.1.63549 WP_005717925.1.65482 WP_005717925.1.65878 WP_005717925.1.66934 WP_005717925.1.66990 WP_005717925.1.70689 WP_005717925.1.72215 WP_005717925.1.73917 WP_005717925.1.74955 WP_005717925.1.75804 WP_005717925.1.78987 WP_005717925.1.79347 WP_005717925.1.79593 WP_005717925.1.80223 WP_005717925.1.80589 WP_005717925.1.80911 WP_005717925.1.81885 WP_005717925.1.8281 WP_005717925.1.83579 WP_005717925.1.86541 WP_005717925.1.87897 WP_005717925.1.88402 WP_005717925.1.89773 WP_005717925.1.90081 WP_005717925.1.90179 WP_005717925.1.90578 WP_005717925.1.91495 WP_005717925.1.92478 WP_005717925.1.92519 WP_005717925.1.93940 WP_005717925.1.94432 WP_005717925.1.94435 WP_005717925.1.95718 WP_005717925.1.9746 WP_005717925.1.9947 272843.PM1408 gi|386835273|ref|YP_006240590.1| gi|383311254|ref|YP_005364064.1| gi|15603273|ref|NP_246347.1| gi|378775257|ref|YP_005177500.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]