SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603294|ref|NP_246368.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603294|ref|NP_246368.1|
Domain Number 1 Region: 103-262
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.9e-35
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000015
Further Details:      
 
Domain Number 2 Region: 3-102
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 7.48e-28
Family Shikimate dehydrogenase-like 0.00000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603294|ref|NP_246368.1|
Sequence length 270
Comment shikimate 5-dehydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MINKETQLCISLAGKPGNFGTAFHNYLYQKLGLNYIYKAFTTSDIEHAVKGVRALGIRGC
AVSMPFKESCMPFLDEISASAKAIESVNTIVNEDGYLKAYNTDYIAISKLIQQYQLDKHH
KVIVQGSGGMAKAVVAAFKNAGFHDLSVYARNATTGQYLANLYGYQYINHLEGNEASILV
NATPMGMSGGEENTLAFPESLIEQASSIFDVVALPAETPLIQYAKQQNKQTISGAEVIVL
QAVEQFELYTHQRPSETLIAEAAEFARSIR
Download sequence
Identical sequences Q9CL19
gi|15603294|ref|NP_246368.1| 272843.PM1429 WP_010907161.1.12311 WP_010907161.1.15732 WP_010907161.1.19996 WP_010907161.1.62389 WP_010907161.1.66990 WP_010907161.1.81885 WP_010907161.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]