SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603296|ref|NP_246370.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603296|ref|NP_246370.1|
Domain Number 1 Region: 185-337
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.36e-55
Family Glycerol-3-phosphate dehydrogenase 0.0000917
Further Details:      
 
Domain Number 2 Region: 10-184
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 8.33e-50
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603296|ref|NP_246370.1|
Sequence length 337
Comment NAD(P)H-dependent glycerol-3-phosphate dehydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNTTVATSPITVLGAGSYGTALAIAFSRNGFPTYLWGHDPVHMQRLSEERQNNAFLPNIA
FPDALHIEFDLASALSQSRDLLIVVPSHVFGEVIDKIKPYLRPDHRIAWATKGLERNTGR
LLQEVIEEKLGTQHPLAVLSGPTFAKELAAGLPTAIALASNNEQFALEFQARIHCSKHFR
VYINQDMIGVQLGGAIKNVIAISAGMSDGMGFGANARTALITRGIAEISRLGASLGANPN
TFMGMSGLGDLVLTCTDDQSRNRRFGIMLGQGFSAQTAMDNIGQVVEGFYNAKEAYLLAQ
RQGIEMPITEQVYQVLFCGKNAQDVAASLLGRERKGE
Download sequence
Identical sequences A0A1E3XIG6 A0A2K2YV09 Q9CL17 V4MTH1
WP_005717960.1.10027 WP_005717960.1.10721 WP_005717960.1.11014 WP_005717960.1.11214 WP_005717960.1.11947 WP_005717960.1.12156 WP_005717960.1.12311 WP_005717960.1.1307 WP_005717960.1.14908 WP_005717960.1.15732 WP_005717960.1.17217 WP_005717960.1.17980 WP_005717960.1.18123 WP_005717960.1.19996 WP_005717960.1.20287 WP_005717960.1.21657 WP_005717960.1.22153 WP_005717960.1.2313 WP_005717960.1.23830 WP_005717960.1.24757 WP_005717960.1.26616 WP_005717960.1.26777 WP_005717960.1.27416 WP_005717960.1.27592 WP_005717960.1.27664 WP_005717960.1.28084 WP_005717960.1.29697 WP_005717960.1.30617 WP_005717960.1.34253 WP_005717960.1.35562 WP_005717960.1.35978 WP_005717960.1.36022 WP_005717960.1.3807 WP_005717960.1.38246 WP_005717960.1.3839 WP_005717960.1.39152 WP_005717960.1.3957 WP_005717960.1.40210 WP_005717960.1.40787 WP_005717960.1.41297 WP_005717960.1.41462 WP_005717960.1.41657 WP_005717960.1.42469 WP_005717960.1.42512 WP_005717960.1.42943 WP_005717960.1.43687 WP_005717960.1.44741 WP_005717960.1.45422 WP_005717960.1.47685 WP_005717960.1.4808 WP_005717960.1.49053 WP_005717960.1.50853 WP_005717960.1.51342 WP_005717960.1.52066 WP_005717960.1.52585 WP_005717960.1.52859 WP_005717960.1.53852 WP_005717960.1.55074 WP_005717960.1.55401 WP_005717960.1.57420 WP_005717960.1.57956 WP_005717960.1.58257 WP_005717960.1.58450 WP_005717960.1.58628 WP_005717960.1.58910 WP_005717960.1.59455 WP_005717960.1.60478 WP_005717960.1.60664 WP_005717960.1.61098 WP_005717960.1.61860 WP_005717960.1.62016 WP_005717960.1.6219 WP_005717960.1.62389 WP_005717960.1.6332 WP_005717960.1.63549 WP_005717960.1.65482 WP_005717960.1.65878 WP_005717960.1.66934 WP_005717960.1.66990 WP_005717960.1.70689 WP_005717960.1.72215 WP_005717960.1.73917 WP_005717960.1.74955 WP_005717960.1.75804 WP_005717960.1.78987 WP_005717960.1.79347 WP_005717960.1.79593 WP_005717960.1.80223 WP_005717960.1.80589 WP_005717960.1.80911 WP_005717960.1.81885 WP_005717960.1.8281 WP_005717960.1.83579 WP_005717960.1.86541 WP_005717960.1.87897 WP_005717960.1.89773 WP_005717960.1.90081 WP_005717960.1.90179 WP_005717960.1.90578 WP_005717960.1.91495 WP_005717960.1.94432 WP_005717960.1.94435 WP_005717960.1.95718 WP_005717960.1.9746 WP_005717960.1.9947 gi|386835298|ref|YP_006240615.1| 272843.PM1431 gi|15603296|ref|NP_246370.1| gi|383311279|ref|YP_005364089.1| gi|378775282|ref|YP_005177525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]