SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603313|ref|NP_246387.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603313|ref|NP_246387.1|
Domain Number 1 Region: 20-341
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 3.14e-119
Family Tex N-terminal region-like 0.00000000745
Further Details:      
 
Domain Number 2 Region: 342-488
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.55e-48
Family Tex RuvX-like domain-like 0.00000298
Further Details:      
 
Domain Number 3 Region: 489-575
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.45e-28
Family Tex HhH-containing domain-like 0.000072
Further Details:      
 
Domain Number 4 Region: 656-741
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.5e-26
Family Cold shock DNA-binding domain-like 0.0000351
Further Details:      
 
Domain Number 5 Region: 579-651
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.13e-20
Family Tex HhH-containing domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603313|ref|NP_246387.1|
Sequence length 791
Comment hypothetical protein PM1448 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLKAGSSSLFLLLFSECYSMLNQQISQIIATELTVQPQQILAAIQLVDDGNTIPFIARYR
KEVTGGLDDTQLRHFETRLIYLRELEDRRQTILKSIEEQGKLTDDLRNQIQQVQSKTELE
DLYLPYKPKRRTKGQIAIEAGLEPLADLLWSQPENDPETTALSFVDAEKGVVDSKAALDG
AKYILMERFAEDAALLAKVRAYLQQSAVIFSKVLEGKEAEGAKFQDYFDHQELLKNVPSH
RALAMFRGRNEGVLQLGLNADPEQEEGVRQSYCEEIIRDHLGVRFSGQPADKWREQVIAW
TWKIKVALHLETELMASLREKAEDEAIDVFARNLTALLMAAPAGAKNTMGLDPGLRTGVK
VAVVDNTGKLLATDTIYPHTGQMDNAMTTLYRLIKAHQVELIAIGNGTASRETERFAKEV
IKAIEGNKPQTVVVSEAGASVYSASELAAAEFPELDVSLRGAVSIARRLQDPLAELVKIE
PKAIGVGQYQHDVNQSQLARKLDAVVEDCVNAVGVDLNTASAPLLARVAGMTKTLAQNIV
AYRDENGRFDSRDQLKKVPRLGPKAFEQCAGFMRIAAGKNPLDASGVHPEAYPVVEKILQ
ATEQSIHDLMGNTSAVRQLDAKKFIDDQFGLPTVQDIFKELEKPGRDPRGEFKTATFMDG
VEDINDLKVGMILEGTVTNVTNFGAFVDIGVHQDGLVHISSLSDKFVEDPHQVVKTGDIV
KVKVLEVDVPRKRIALTMRLEEKPVDKNVAKTDRTLSARPRNNPATKGRDRNTANSAMGN
AFADALKNWKK
Download sequence
Identical sequences Q9CL01
272843.PM1448 gi|15603313|ref|NP_246387.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]