SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603322|ref|NP_246396.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603322|ref|NP_246396.1|
Domain Number 1 Region: 24-323
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.36e-63
Family Phosphate binding protein-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603322|ref|NP_246396.1|
Sequence length 329
Comment hypothetical protein PM1457 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKTFSSALIALGLSMTIAGVAHANEKLIVYTSMKESLIGALKTKFNEKHPDIAMDYQSA
GAGKLMAKIAAEKESGQIMADVIWTSEVPDFFKMKANGMLDAYVSPEVEHIVNPIPDFDG
SFTPIRLGTLGIAYNTRFVKEPPTSWDDITGAKYKGAFGIANPALSGTAYMSVALLKSTF
GWEFFEKIKANKGKVGKGSGQVVDDTASGDLLASLAVDYITNDKIKKGAQLKLVYPKEML
VIPSPAAIFKGTKNPAAAKKFIDFLLSEEAQHIIAHEGTLPVRKGVATLEGMPTVEDAIS
RAIPIDYQAILTEKEEIVKKFTQILQGRQ
Download sequence
Identical sequences A0A1D7R5B3 J6CL92 Q9CKZ3
gi|15603322|ref|NP_246396.1| WP_005724123.1.10027 WP_005724123.1.10721 WP_005724123.1.11214 WP_005724123.1.11947 WP_005724123.1.12156 WP_005724123.1.12311 WP_005724123.1.1307 WP_005724123.1.14908 WP_005724123.1.15732 WP_005724123.1.17217 WP_005724123.1.17980 WP_005724123.1.18123 WP_005724123.1.19996 WP_005724123.1.20287 WP_005724123.1.21657 WP_005724123.1.22153 WP_005724123.1.2313 WP_005724123.1.24757 WP_005724123.1.26616 WP_005724123.1.26777 WP_005724123.1.27416 WP_005724123.1.27592 WP_005724123.1.28084 WP_005724123.1.29697 WP_005724123.1.30617 WP_005724123.1.34253 WP_005724123.1.35562 WP_005724123.1.35978 WP_005724123.1.36022 WP_005724123.1.3807 WP_005724123.1.38246 WP_005724123.1.3839 WP_005724123.1.39152 WP_005724123.1.3957 WP_005724123.1.40210 WP_005724123.1.40787 WP_005724123.1.41351 WP_005724123.1.41462 WP_005724123.1.41657 WP_005724123.1.41667 WP_005724123.1.42512 WP_005724123.1.42943 WP_005724123.1.43687 WP_005724123.1.44741 WP_005724123.1.45422 WP_005724123.1.47685 WP_005724123.1.4808 WP_005724123.1.49053 WP_005724123.1.50853 WP_005724123.1.51342 WP_005724123.1.52066 WP_005724123.1.52585 WP_005724123.1.52859 WP_005724123.1.53852 WP_005724123.1.55074 WP_005724123.1.55401 WP_005724123.1.57420 WP_005724123.1.57956 WP_005724123.1.58111 WP_005724123.1.58257 WP_005724123.1.58450 WP_005724123.1.58628 WP_005724123.1.58910 WP_005724123.1.59455 WP_005724123.1.60478 WP_005724123.1.60664 WP_005724123.1.61098 WP_005724123.1.61860 WP_005724123.1.62016 WP_005724123.1.6219 WP_005724123.1.62389 WP_005724123.1.6332 WP_005724123.1.63549 WP_005724123.1.65482 WP_005724123.1.65878 WP_005724123.1.66934 WP_005724123.1.66990 WP_005724123.1.70689 WP_005724123.1.72215 WP_005724123.1.73917 WP_005724123.1.74955 WP_005724123.1.75804 WP_005724123.1.78987 WP_005724123.1.79347 WP_005724123.1.79593 WP_005724123.1.80223 WP_005724123.1.80589 WP_005724123.1.80911 WP_005724123.1.81885 WP_005724123.1.8281 WP_005724123.1.83579 WP_005724123.1.86541 WP_005724123.1.87897 WP_005724123.1.88402 WP_005724123.1.89773 WP_005724123.1.90081 WP_005724123.1.90179 WP_005724123.1.91495 WP_005724123.1.92478 WP_005724123.1.93940 WP_005724123.1.94432 WP_005724123.1.94435 WP_005724123.1.95718 WP_005724123.1.9746 WP_005724123.1.9947 gi|378775308|ref|YP_005177551.1| gi|386835330|ref|YP_006240647.1| 272843.PM1457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]