SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603323|ref|NP_246397.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603323|ref|NP_246397.1|
Domain Number 1 Region: 25-321
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.58e-39
Family Phosphate binding protein-like 0.0023
Further Details:      
 
Weak hits

Sequence:  gi|15603323|ref|NP_246397.1|
Domain Number - Region: 305-385
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0497
Family DNA repair protein MutS, domain III 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603323|ref|NP_246397.1|
Sequence length 411
Comment protein PgtC [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MHSKRQNYIIYFVVTLLAFIHPIKAEELVIGTTFALEGVQHLIKEWNKQPDSFPITTLNR
TSASLNQLLSTEKAREVDLILSSSPMLFYNLQHKNKLAPLPPNIEHDTRFLPDLLQPTTV
AFALSGYGMLFNIPLLQQTHLPFPQSWQDLTHPDLQGLVIISSPTRSDTNHIMVEALLQR
YGWQQGWELIEKIMLNVGTISSRSFGVVDKVQANLGAVGITIDNYAHILTTQDQSHLAFH
YFPDFPISPTFIAVVAESRKKQHAFRFIRFLLSATGQQILTDPQMSKYPITPLPASHPQA
ALQQQLFAQPPLDYHLLIKRQELVKLLFEQQITHRLSLLKEHWHLLHQKERALNRPLPEL
RQILTALPVSAEQAENDDYLTHFNRSQELLNWQHFFIAQQLAFVNALENQE
Download sequence
Identical sequences Q9CKZ2
gi|15603323|ref|NP_246397.1| WP_010907173.1.11214 WP_010907173.1.11947 WP_010907173.1.12311 WP_010907173.1.15732 WP_010907173.1.19996 WP_010907173.1.24757 WP_010907173.1.26777 WP_010907173.1.28084 WP_010907173.1.35562 WP_010907173.1.3807 WP_010907173.1.3839 WP_010907173.1.40787 WP_010907173.1.43687 WP_010907173.1.60478 WP_010907173.1.62389 WP_010907173.1.6332 WP_010907173.1.63549 WP_010907173.1.66990 WP_010907173.1.70689 WP_010907173.1.72215 WP_010907173.1.78987 WP_010907173.1.81885 WP_010907173.1.9947 272843.PM1458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]