SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603331|ref|NP_246405.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603331|ref|NP_246405.1|
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily YjgF-like 6.28e-44
Family YjgF/L-PSP 0.000000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603331|ref|NP_246405.1|
Sequence length 129
Comment hypothetical protein PM1466 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTKVIHTDNAPAAIGPYVQAVDLGNMLLTSGQIPVNPKTGEVPADIVAQARQSLENVKAI
VEQAGLQVANIVKTTVFVKDLNDFAAVNAEYERFFKENNHPSFPARSCVEVARLPKDVGI
EIEAIAVKA
Download sequence
Identical sequences A0A1E3XHX5 A0A2K2YUM2 Q9L6B5 V4Q0J3
WP_005718022.1.10027 WP_005718022.1.10721 WP_005718022.1.11214 WP_005718022.1.11947 WP_005718022.1.12156 WP_005718022.1.12311 WP_005718022.1.1307 WP_005718022.1.14908 WP_005718022.1.15732 WP_005718022.1.17217 WP_005718022.1.17980 WP_005718022.1.18123 WP_005718022.1.19996 WP_005718022.1.20287 WP_005718022.1.21657 WP_005718022.1.22153 WP_005718022.1.2313 WP_005718022.1.23830 WP_005718022.1.24757 WP_005718022.1.26616 WP_005718022.1.26777 WP_005718022.1.27416 WP_005718022.1.27592 WP_005718022.1.27664 WP_005718022.1.28084 WP_005718022.1.29697 WP_005718022.1.30617 WP_005718022.1.34253 WP_005718022.1.35562 WP_005718022.1.35978 WP_005718022.1.36022 WP_005718022.1.3807 WP_005718022.1.38246 WP_005718022.1.3839 WP_005718022.1.39152 WP_005718022.1.3957 WP_005718022.1.40210 WP_005718022.1.40787 WP_005718022.1.41297 WP_005718022.1.41351 WP_005718022.1.41462 WP_005718022.1.41657 WP_005718022.1.41667 WP_005718022.1.4211 WP_005718022.1.42512 WP_005718022.1.42943 WP_005718022.1.43687 WP_005718022.1.44741 WP_005718022.1.45422 WP_005718022.1.47685 WP_005718022.1.4808 WP_005718022.1.49053 WP_005718022.1.50853 WP_005718022.1.51342 WP_005718022.1.52066 WP_005718022.1.52585 WP_005718022.1.52859 WP_005718022.1.53852 WP_005718022.1.55074 WP_005718022.1.55401 WP_005718022.1.57420 WP_005718022.1.57956 WP_005718022.1.58111 WP_005718022.1.58257 WP_005718022.1.58450 WP_005718022.1.58628 WP_005718022.1.58910 WP_005718022.1.59455 WP_005718022.1.60478 WP_005718022.1.60664 WP_005718022.1.61098 WP_005718022.1.61860 WP_005718022.1.62016 WP_005718022.1.6219 WP_005718022.1.62389 WP_005718022.1.6332 WP_005718022.1.63549 WP_005718022.1.65482 WP_005718022.1.65878 WP_005718022.1.66934 WP_005718022.1.66990 WP_005718022.1.70689 WP_005718022.1.72215 WP_005718022.1.73917 WP_005718022.1.74955 WP_005718022.1.75804 WP_005718022.1.78987 WP_005718022.1.79347 WP_005718022.1.79593 WP_005718022.1.80223 WP_005718022.1.80589 WP_005718022.1.80911 WP_005718022.1.81885 WP_005718022.1.8281 WP_005718022.1.83579 WP_005718022.1.86541 WP_005718022.1.87897 WP_005718022.1.88402 WP_005718022.1.89773 WP_005718022.1.90081 WP_005718022.1.90179 WP_005718022.1.91495 WP_005718022.1.92478 WP_005718022.1.93940 WP_005718022.1.94432 WP_005718022.1.94435 WP_005718022.1.95718 WP_005718022.1.9746 WP_005718022.1.9947 272843.PM1466 gi|15603331|ref|NP_246405.1| gi|386835338|ref|YP_006240655.1| gi|378775317|ref|YP_005177560.1| gi|383311320|ref|YP_005364130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]