SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603341|ref|NP_246415.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603341|ref|NP_246415.1|
Domain Number 1 Region: 397-563,733-799
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 4.97e-86
Family Type II DNA topoisomerase 0.00054
Further Details:      
 
Domain Number 2 Region: 9-221
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.6e-77
Family DNA gyrase/MutL, N-terminal domain 0.0000000345
Further Details:      
 
Domain Number 3 Region: 224-395
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.47e-61
Family DNA gyrase/MutL, second domain 0.0000000713
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603341|ref|NP_246415.1|
Sequence length 806
Comment DNA gyrase subunit B [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSNNTPENYGANSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNSIDEALAGYA
KDITVTIHTDNSVSVQDDGRGIPVDIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLH
GVGVSVVNALSDKLQLTIRRQGKVHEQIYHLGEPQAPLAAIGETDQTGTTVRFWPSPTIF
NNIEFEYDILAKRLRELSFLNSGVSIKLFDKRNDRQDHFHYEGGIQAFVEYLNRNKNPIH
QKPFYFSTEKDGIGVEVSMQWNDSFNENVYCFTNNIPQRDGGTHLAGFRGALTRSLNNYM
DNEGHNKKSKVATSGDDAREGLVAIISVKVPDPKFSSQTKDKLVSSEVKSAVESVMNEYL
QQYLLENPSDAKIIVGKIIDAARAREAARKAREMTRRKGALDLGGLPGKLADCQERDPAL
SELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARFDKMLSSAEVGTLITALGCG
IGRDEYNPEKLRYHSIIIMTDADVDGAHIRTLLLTFFYRQMPELIERGHVYIAQPPLYKV
KKGKQEQYIKDDEAMVQYEVALALENAALYVNENAPAMSGLALESLVSEYNAVQKMIGRL
TRYYPEVVLKELIYHPELTSELMADQKEVENWIATLVDKLVAKESNGNHYSYRTVFNSER
HLHEAVLTVRTHGIDTDYFLNFQFATGSEYARIVKLGKQLTGLIEEGAYIMRGERKLEVS
SFEQAIEWLVKESRRGLMVQRYKGLGEMNPEQLWETTMDPNARRMLKVSIKDAVAADLLF
TTLMGDEVEPRREFIESNALHANLDI
Download sequence
Identical sequences Q9CKX5
272843.PM1476 gi|15603341|ref|NP_246415.1| WP_010907187.1.19996 WP_010907187.1.40210 WP_010907187.1.45422 WP_010907187.1.4808 WP_010907187.1.53852 WP_010907187.1.6219 WP_010907187.1.66990 WP_010907187.1.81885 WP_010907187.1.8281 WP_010907187.1.89773 WP_010907187.1.9746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]