SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603347|ref|NP_246421.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603347|ref|NP_246421.1|
Domain Number 1 Region: 1-325
Classification Level Classification E-value
Superfamily Carbohydrate phosphatase 1.16e-112
Family GlpX-like bacterial fructose-1,6-bisphosphatase 0.000000000876
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603347|ref|NP_246421.1|
Sequence length 337
Comment fructose 1,6-bisphosphatase II [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNRALAIEFSRVTEAAALAGFAWLGRGDKEAADNAAVQAMRLMLNQVEMDAEVVIGEGEI
DEAPMLYIGEKVGNGKGEQISIAVDPIEGTRMTAMGQANALSVLAAGGKETFLKAPDMYM
EKLVVGPEVKGMVDLNLPLEQNLRRVASKMGKLLSQLTVITLDKPRHHEMIKRMQQLGVK
VLAIPDGDVAASILCCLPDGGVDMLYGIGGAPEGVIAAAAVRALGGDMQARLLPRDHVKG
DTPENQALAAEEIRRCQEMGIEVNQVLKLEDLVRDDNLVFSATGITNGDLLKGIHRKGNL
ATTETLLIRGRSRTIRRIQSVHYLDRKDTALYRIIGA
Download sequence
Identical sequences A0A1E3XHV5 A0A2K2YUF9 Q9CKW9 V4Q0H8
gi|386835354|ref|YP_006240671.1| gi|378775333|ref|YP_005177576.1| gi|15603347|ref|NP_246421.1| WP_005724182.1.10027 WP_005724182.1.10721 WP_005724182.1.11014 WP_005724182.1.12311 WP_005724182.1.1307 WP_005724182.1.14908 WP_005724182.1.15732 WP_005724182.1.17217 WP_005724182.1.17980 WP_005724182.1.18123 WP_005724182.1.19996 WP_005724182.1.20287 WP_005724182.1.22153 WP_005724182.1.2313 WP_005724182.1.23830 WP_005724182.1.26616 WP_005724182.1.26777 WP_005724182.1.27416 WP_005724182.1.27664 WP_005724182.1.29697 WP_005724182.1.30617 WP_005724182.1.34253 WP_005724182.1.35978 WP_005724182.1.36022 WP_005724182.1.39152 WP_005724182.1.3957 WP_005724182.1.40210 WP_005724182.1.41351 WP_005724182.1.41462 WP_005724182.1.41657 WP_005724182.1.41667 WP_005724182.1.42469 WP_005724182.1.42943 WP_005724182.1.44741 WP_005724182.1.45422 WP_005724182.1.47685 WP_005724182.1.4808 WP_005724182.1.50853 WP_005724182.1.52066 WP_005724182.1.53852 WP_005724182.1.55074 WP_005724182.1.57420 WP_005724182.1.57956 WP_005724182.1.58111 WP_005724182.1.58450 WP_005724182.1.58628 WP_005724182.1.58910 WP_005724182.1.59455 WP_005724182.1.60664 WP_005724182.1.61098 WP_005724182.1.61860 WP_005724182.1.62016 WP_005724182.1.6219 WP_005724182.1.62389 WP_005724182.1.65482 WP_005724182.1.65878 WP_005724182.1.66934 WP_005724182.1.66990 WP_005724182.1.70689 WP_005724182.1.73917 WP_005724182.1.74955 WP_005724182.1.75804 WP_005724182.1.79593 WP_005724182.1.80223 WP_005724182.1.80589 WP_005724182.1.80911 WP_005724182.1.81885 WP_005724182.1.8281 WP_005724182.1.86541 WP_005724182.1.87897 WP_005724182.1.88402 WP_005724182.1.89773 WP_005724182.1.90081 WP_005724182.1.90179 WP_005724182.1.90578 WP_005724182.1.91495 WP_005724182.1.92478 WP_005724182.1.93940 WP_005724182.1.94432 WP_005724182.1.94435 WP_005724182.1.95718 WP_005724182.1.9746 WP_005724182.1.9947 272843.PM1482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]