SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603357|ref|NP_246431.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603357|ref|NP_246431.1|
Domain Number 1 Region: 96-381
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.01e-95
Family RecA protein-like (ATPase-domain) 0.0000000103
Further Details:      
 
Domain Number 2 Region: 383-510
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 8.63e-45
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0000761
Further Details:      
 
Domain Number 3 Region: 10-94
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 6.08e-26
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603357|ref|NP_246431.1|
Sequence length 513
Comment F0F1 ATP synthase subunit alpha [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQLNSTEISELIKKRIAQFDVVSEARNTGTIVSVSDGIIRIHGLSEVMQGEMIALPGNRY
AMALNLERDSVGAVVMGPYADLAEGMEVQCTGRILEVPVGRGLLGRVVNTLGEPIDGKGE
IENDGFSPVEVIAPGVIDRKSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI
DAIINQRDSGIKCIYVAIGQKASTIANVVRKLEEHSALQNTIVVVASASESAALQYLAPY
SGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER
ASRVNEEYVERFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF
NSGIRPAVNPGISVSRVGGSAQTKVIKKLAGGIRTALAQYRELAAFAQFASDLDDATRKQ
LSHGQKVTELLKQKQYSPLSVAQQALVLFAVEFGYLEEVDLDRIGSFESALLEYANHNYA
DFMRELTQSGNYNDEIKESLKGILDSFKANSAW
Download sequence
Identical sequences Q9CKW2
272843.PM1492 WP_010907192.1.12311 WP_010907192.1.15732 WP_010907192.1.19996 WP_010907192.1.40210 WP_010907192.1.45422 WP_010907192.1.4808 WP_010907192.1.53852 WP_010907192.1.6219 WP_010907192.1.62389 WP_010907192.1.66990 WP_010907192.1.81885 WP_010907192.1.8281 WP_010907192.1.89773 WP_010907192.1.9746 WP_010907192.1.9947 gi|15603357|ref|NP_246431.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]