SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603359|ref|NP_246433.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603359|ref|NP_246433.1|
Domain Number 1 Region: 74-345
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.66e-90
Family RecA protein-like (ATPase-domain) 0.00000000659
Further Details:      
 
Domain Number 2 Region: 342-456
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 6.28e-55
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000447
Further Details:      
 
Domain Number 3 Region: 1-72
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 1.1e-24
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603359|ref|NP_246433.1|
Sequence length 457
Comment F0F1 ATP synthase subunit beta [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MATGKIVQIIGAVIDVEFPQDAVPKVYDALNVETGLVLEVQQQLGGGVVRCIAMGSSDGL
KRGLSVTNTNNPISVPVGTKTLGRIMNVLGEPIDEQGEIGAEENWSIHRAPPSYEEQSNS
TELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGER
TREGNDFYHEMKDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLFFVD
NIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADD
LTDPSPATTFAHLDSTVVLSRQIASLGIYPAVDPLESTSRQLDPLVVGEEHYNVARGVQT
TLQRYKELKDIIAILGMDELSEEDKLVVARARKIERFLSQPFFVAEVFNGTPGKYVPLKE
TIRGFKGILDGEYDHIPEQAFYMAGTIDEVLEKAKKL
Download sequence
Identical sequences A0A126QDW6 A0A2K2YUM1 Q9CKW1 V4N9I3
gi|386835366|ref|YP_006240683.1| gi|378775345|ref|YP_005177588.1| gi|383311348|ref|YP_005364158.1| WP_005724211.1.10027 WP_005724211.1.11014 WP_005724211.1.12311 WP_005724211.1.1307 WP_005724211.1.14908 WP_005724211.1.15732 WP_005724211.1.17217 WP_005724211.1.17980 WP_005724211.1.18123 WP_005724211.1.19996 WP_005724211.1.20287 WP_005724211.1.21657 WP_005724211.1.22153 WP_005724211.1.2313 WP_005724211.1.23830 WP_005724211.1.24757 WP_005724211.1.26616 WP_005724211.1.26777 WP_005724211.1.27416 WP_005724211.1.27592 WP_005724211.1.27664 WP_005724211.1.29697 WP_005724211.1.30617 WP_005724211.1.34253 WP_005724211.1.35978 WP_005724211.1.36022 WP_005724211.1.39152 WP_005724211.1.3957 WP_005724211.1.40210 WP_005724211.1.40787 WP_005724211.1.41297 WP_005724211.1.41351 WP_005724211.1.41462 WP_005724211.1.41657 WP_005724211.1.41667 WP_005724211.1.4211 WP_005724211.1.42469 WP_005724211.1.42512 WP_005724211.1.42943 WP_005724211.1.44741 WP_005724211.1.45422 WP_005724211.1.47685 WP_005724211.1.4808 WP_005724211.1.49053 WP_005724211.1.50853 WP_005724211.1.51342 WP_005724211.1.52066 WP_005724211.1.53852 WP_005724211.1.55074 WP_005724211.1.57420 WP_005724211.1.57956 WP_005724211.1.58111 WP_005724211.1.58450 WP_005724211.1.58628 WP_005724211.1.58910 WP_005724211.1.59455 WP_005724211.1.60664 WP_005724211.1.61098 WP_005724211.1.61860 WP_005724211.1.62016 WP_005724211.1.6219 WP_005724211.1.62389 WP_005724211.1.65482 WP_005724211.1.65878 WP_005724211.1.66934 WP_005724211.1.66990 WP_005724211.1.70689 WP_005724211.1.73917 WP_005724211.1.74955 WP_005724211.1.75804 WP_005724211.1.79593 WP_005724211.1.80223 WP_005724211.1.80589 WP_005724211.1.80911 WP_005724211.1.81885 WP_005724211.1.8281 WP_005724211.1.86541 WP_005724211.1.87897 WP_005724211.1.88402 WP_005724211.1.89773 WP_005724211.1.90081 WP_005724211.1.90179 WP_005724211.1.90578 WP_005724211.1.91495 WP_005724211.1.92478 WP_005724211.1.93940 WP_005724211.1.94432 WP_005724211.1.94435 WP_005724211.1.95718 WP_005724211.1.9746 WP_005724211.1.9947 gi|15603359|ref|NP_246433.1| 272843.PM1494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]