SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603362|ref|NP_246436.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603362|ref|NP_246436.1|
Domain Number 1 Region: 3-131
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.45e-45
Family YigZ N-terminal domain-like 0.00000533
Further Details:      
 
Domain Number 2 Region: 136-200
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000000000127
Family YigZ C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603362|ref|NP_246436.1|
Sequence length 202
Comment hypothetical protein PM1497 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MIEYKIPKSAVIFEEEIKKSRFITYLQHVENLTQAKAFWQQIKSQHPQARHHCWATIAGA
PNDSQQFGFSDDGEPAGTAGKPMLSALQGSKIGEICAVVVRYYGGILLGTGGLVRAYGNG
VQQALTLLETVVKVQRQSYKVHCDYSHINALQLLCEKQDVMIINQHFVDRVAFELGIRDD
KLTAFEQALIERFSGQLQLERE
Download sequence
Identical sequences Q9CKV8
gi|15603362|ref|NP_246436.1| 272843.PM1497 WP_005757672.1.11014 WP_005757672.1.12311 WP_005757672.1.15732 WP_005757672.1.19996 WP_005757672.1.26777 WP_005757672.1.40210 WP_005757672.1.42469 WP_005757672.1.45422 WP_005757672.1.4808 WP_005757672.1.53852 WP_005757672.1.6219 WP_005757672.1.62389 WP_005757672.1.66990 WP_005757672.1.81885 WP_005757672.1.8281 WP_005757672.1.89773 WP_005757672.1.90578 WP_005757672.1.9746 WP_005757672.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]