SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603367|ref|NP_246441.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603367|ref|NP_246441.1|
Domain Number 1 Region: 175-372
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 5.66e-61
Family Class I glutamine amidotransferases (GAT) 0.000000288
Further Details:      
 
Domain Number 2 Region: 4-148
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, small subunit N-terminal domain 4.58e-57
Family Carbamoyl phosphate synthetase, small subunit N-terminal domain 0.00000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603367|ref|NP_246441.1|
Sequence length 385
Comment carbamoyl phosphate synthase small subunit [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSEPAILVLADGSVFHGTSIGAKGHTVGEVVFNTAMTGYQEILTDPSYFRQIVTLTYPHI
GNTGTNLEDCEANHVYASGLIIRDLPLLHSNFRSSMSLRDYLQTHNVVAIADIDTRRLTR
ILRDKGAQAGCIMTGEIDEAKALELAKSFGSMAGKDLAQEVSTGEIFTWTSGQWQLGKGF
IEQTQAEFNVVAYDFGVKHNILRMLAERGCKITVVPAKTSAEQVLALNPDGIFLSNGPGD
PEPCDYAISAIQTLLASKKPIFGICLGHQLLGLAAGGKTKKMAFGHHGANHPVQDLNTQK
VFITSQNHGFEVDEASLPSHVRVTHRSLFDNSVQGIELSDQSAFSFQGHPEASPGPNDVA
YLFDKFINEMRKANLSQLSTYVAHH
Download sequence
Identical sequences A0A2J9R7M8 Q9CKV3
272843.PM1502 gi|15603367|ref|NP_246441.1| WP_005757678.1.11014 WP_005757678.1.12311 WP_005757678.1.15732 WP_005757678.1.19996 WP_005757678.1.24757 WP_005757678.1.26777 WP_005757678.1.40210 WP_005757678.1.40787 WP_005757678.1.42469 WP_005757678.1.45422 WP_005757678.1.4808 WP_005757678.1.53852 WP_005757678.1.6219 WP_005757678.1.62389 WP_005757678.1.66990 WP_005757678.1.81885 WP_005757678.1.8281 WP_005757678.1.89773 WP_005757678.1.90578 WP_005757678.1.9746 WP_005757678.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]