SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603375|ref|NP_246449.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603375|ref|NP_246449.1|
Domain Number 1 Region: 193-504
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.01e-48
Family Extended AAA-ATPase domain 0.002
Further Details:      
 
Domain Number 2 Region: 8-169
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.21e-33
Family ATP-dependent protease Lon (La), catalytic domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603375|ref|NP_246449.1|
Sequence length 509
Comment protein ComM [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSLAIVYSRASMGVQAPLVTIEVHFSNGKPQFNLVGLPEKTVKEAQDRVRSALLNAQFKY
PAKRITVNLAPADLPKEGGRFDLPIAIGMLAASGQIDPQKLQQFEFVGELALTGDLRAVH
GVIPAILAAQKAKRKLIIASQNANEASLVSQQDTYFAQDLLEVVNFLNDHTTLPLASELP
TQHDPALLATTQKDLTDIIGQSHAKRALTIAAAGQHNLLFLGPPGTGKTMLASRLTTLLP
EMNDQEAIETAAVTSLVHHELNFHNWKQRPFRAPHHSASTPALVGGGTIPKPGEISLAHN
GVLFLDELPEFERKVLDALRQPLESGEIIISRANAKIQFPARFQLIAAMNPSPTGHYQGT
HNRTSPQQILRYLNRLSGPFLDRFDLSIEVPLLPKGALQQQTDRGESSAQVREKVLKVRD
IQLARAGKINAYLTSKEIERDCKISDQDALFLENALAKLGLSVRAYHRILKVARTIADLN
NERQIQQCHLAEALGYRAMDRLLQKLSAM
Download sequence
Identical sequences Q9CKU5
gi|15603375|ref|NP_246449.1| 272843.PM1510 WP_005755087.1.14908 WP_005755087.1.19996 WP_005755087.1.3957 WP_005755087.1.61098 WP_005755087.1.66990 WP_005755087.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]