SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603388|ref|NP_246462.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603388|ref|NP_246462.1|
Domain Number 1 Region: 22-291
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 1.48e-83
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00049
Further Details:      
 
Domain Number 2 Region: 281-502
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 3.14e-44
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603388|ref|NP_246462.1|
Sequence length 532
Comment hypothetical protein PM1523 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTQAEKKQHKLPDDYRKEKNRPFTGEEYLASLRDGRKVYIYGELVDDVTTHPAFRNAAAS
VAKLYDALHDPATKDELCWETDTGNGGYTHKFFRYARTAEELKAQRDAIAAWSRFSYGWM
GRTPDYKAAFGSALGANPEFYGKFADNARNWYKRIQESCLYFNHAIVNPPIDRNKPIDQV
KDIYVKIEEERADGIVVSGAKVVATNSALTHYNFIGFGSAQIIGDNDDFALMFIAPMDAE
GVKLICRHSYELAAGATGSPFDFPLSTRFDENDAILVLDSVFIPWENILIYRDLERCRTW
AQYAGFATLFPMQACTRLAVKLDFITGLLHKALQCTGVIEFRGVAAQMGEVMMYRNLFWT
LTDAMAGSSYQWKNGCQMPSAQAIQTYRVMAPMAYHTVKKIIEQTVTSGLIYLPSHIRDF
NNPEIDQYLEKYVRGSNNIEYRDRIKILKLLWDAIGTEFGGRHELYEINYAGSQEEVRLQ
VLGQSTGNGTLQRCFDLVDKCLADYDEKGWKVPHLNNSEDINILHNLNRFSK
Download sequence
Identical sequences A0A1D7R559 Q9CKT3 V4MT94
gi|383311379|ref|YP_005364189.1| gi|378775378|ref|YP_005177621.1| gi|15603388|ref|NP_246462.1| gi|386835397|ref|YP_006240715.1| WP_005755115.1.10027 WP_005755115.1.10721 WP_005755115.1.11014 WP_005755115.1.12311 WP_005755115.1.1307 WP_005755115.1.14908 WP_005755115.1.15732 WP_005755115.1.17217 WP_005755115.1.17980 WP_005755115.1.18123 WP_005755115.1.19996 WP_005755115.1.20287 WP_005755115.1.21657 WP_005755115.1.22153 WP_005755115.1.2313 WP_005755115.1.23830 WP_005755115.1.26616 WP_005755115.1.26777 WP_005755115.1.27416 WP_005755115.1.27592 WP_005755115.1.29697 WP_005755115.1.30617 WP_005755115.1.34253 WP_005755115.1.35978 WP_005755115.1.39152 WP_005755115.1.3957 WP_005755115.1.40210 WP_005755115.1.41297 WP_005755115.1.41462 WP_005755115.1.41657 WP_005755115.1.42469 WP_005755115.1.42512 WP_005755115.1.42943 WP_005755115.1.44741 WP_005755115.1.45422 WP_005755115.1.47685 WP_005755115.1.4808 WP_005755115.1.50853 WP_005755115.1.51342 WP_005755115.1.52066 WP_005755115.1.53852 WP_005755115.1.55074 WP_005755115.1.57420 WP_005755115.1.57956 WP_005755115.1.58450 WP_005755115.1.58910 WP_005755115.1.59455 WP_005755115.1.60664 WP_005755115.1.61860 WP_005755115.1.62016 WP_005755115.1.6219 WP_005755115.1.62389 WP_005755115.1.65482 WP_005755115.1.65878 WP_005755115.1.66934 WP_005755115.1.66990 WP_005755115.1.73917 WP_005755115.1.74955 WP_005755115.1.75804 WP_005755115.1.79593 WP_005755115.1.80223 WP_005755115.1.80589 WP_005755115.1.80911 WP_005755115.1.81885 WP_005755115.1.8281 WP_005755115.1.86541 WP_005755115.1.87897 WP_005755115.1.89773 WP_005755115.1.90081 WP_005755115.1.90179 WP_005755115.1.90578 WP_005755115.1.91495 WP_005755115.1.94432 WP_005755115.1.94435 WP_005755115.1.9746 272843.PM1523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]