SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603390|ref|NP_246464.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15603390|ref|NP_246464.1|
Domain Number - Region: 58-120,152-265
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00217
Family Phosphate binding protein-like 0.042
Further Details:      
 
Domain Number - Region: 43-93
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00792
Family Transferrin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603390|ref|NP_246464.1|
Sequence length 340
Comment hypothetical protein PM1525 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKTRQLLLALTLATSASAMANDKVVLKIGHFLPALSTMHNDVLVPWCQDLNTESKGRIEC
QLYPSNQLGGTAGQLIDQVRNGVADIVWTAPGYSPGRFKIIEALETPFLLPNVRVGNKVA
WEFFEKYAKDTEFKQFKVLSIQSDGGVTFHSNKPLNEVEDLKNNKLRTPTRLASQVIQAL
GGAAISIAPSQVAESISKGVVDGAMGAWEVVPPTKLDEVTKYHVMPAVGEPFPTVTVLAL
VMNQKKYDSLPADLKAILDKHSGPALLERITVAWEKTEDNARKKVLANGGVITEFGPKHT
AKMKAMTDSLTKDWIESMNKQGKNGQQLIDDLREMVKKHQ
Download sequence
Identical sequences Q9CKT1
gi|15603390|ref|NP_246464.1| 272843.PM1525 WP_005757713.1.11014 WP_005757713.1.12311 WP_005757713.1.15732 WP_005757713.1.19996 WP_005757713.1.40210 WP_005757713.1.42469 WP_005757713.1.45422 WP_005757713.1.4808 WP_005757713.1.53852 WP_005757713.1.55074 WP_005757713.1.6219 WP_005757713.1.62389 WP_005757713.1.66990 WP_005757713.1.81885 WP_005757713.1.8281 WP_005757713.1.89773 WP_005757713.1.90578 WP_005757713.1.9746 WP_005757713.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]