SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603393|ref|NP_246467.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603393|ref|NP_246467.1|
Domain Number 1 Region: 18-223
Classification Level Classification E-value
Superfamily FAH 1.57e-42
Family FAH 0.0000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603393|ref|NP_246467.1|
Sequence length 224
Comment protein HpaG [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSVSLAKQITQLNTAHKPTVFVIALNSTQLLQRCQAQFEQAPYQALPKTPVIYVLPEATH
NRSGANVSLPAGKKQLRMEPHLAVVFGRDTSRVCVEQAMHYVSGYLPVALYSLPHDSYYR
PDIEGRCQEGFCVLGQEVLKSAVQNPAELTINITVNGSVKKSYVHLAMKHSIPELISFLS
QFIAFKAGDILLTGTEDMPLLVGAGDQVSVEFAQLGCLTNTVTE
Download sequence
Identical sequences Q9CKS8
WP_010907208.1.12311 WP_010907208.1.15732 WP_010907208.1.19996 WP_010907208.1.40210 WP_010907208.1.45422 WP_010907208.1.4808 WP_010907208.1.53852 WP_010907208.1.6219 WP_010907208.1.62389 WP_010907208.1.66990 WP_010907208.1.81885 WP_010907208.1.8281 WP_010907208.1.89773 WP_010907208.1.9746 WP_010907208.1.9947 gi|15603393|ref|NP_246467.1| 272843.PM1528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]