SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603394|ref|NP_246468.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603394|ref|NP_246468.1|
Domain Number 1 Region: 39-248
Classification Level Classification E-value
Superfamily FAH 3.92e-73
Family FAH 0.0000000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603394|ref|NP_246468.1|
Sequence length 254
Comment protein HpaG [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSKYAKVMYQNQIHSVEVRPNGLLTDQQQLLPSEAVTWLPPASGMMYALGLNYADHASEL
DFKPPEKPLVFVKTHHTYTGHNSTTWRPDNVDYMHYECELVVVIGKTAKNVKRDEAMDYV
AGYTLCNDYAIRDYLENYYRPNLRVKNRVGTTPVGPWIVDKADVKDPMNLTLRTWVNGEL
CQEGNTKDMIFDIAYLIEHLSHITTLQPGDMIATGTPKGLADVKPGDCVEIEIEQIGKLT
NYIVSETAFFAQNE
Download sequence
Identical sequences A0A1E3XHR5 Q9CKS7
WP_005757721.1.11014 WP_005757721.1.12311 WP_005757721.1.15732 WP_005757721.1.17980 WP_005757721.1.19996 WP_005757721.1.27592 WP_005757721.1.36022 WP_005757721.1.40210 WP_005757721.1.41657 WP_005757721.1.42469 WP_005757721.1.42512 WP_005757721.1.45422 WP_005757721.1.4808 WP_005757721.1.53852 WP_005757721.1.55074 WP_005757721.1.57956 WP_005757721.1.6219 WP_005757721.1.62389 WP_005757721.1.66990 WP_005757721.1.79593 WP_005757721.1.81885 WP_005757721.1.8281 WP_005757721.1.89773 WP_005757721.1.90578 WP_005757721.1.94432 WP_005757721.1.95718 WP_005757721.1.9746 WP_005757721.1.9947 gi|386835403|ref|YP_006240721.1| 272843.PM1529 gi|15603394|ref|NP_246468.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]