SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603399|ref|NP_246473.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603399|ref|NP_246473.1|
Domain Number 1 Region: 2-267
Classification Level Classification E-value
Superfamily FAH 3.66e-77
Family FAH 0.00000741
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603399|ref|NP_246473.1|
Sequence length 267
Comment protein HpaH [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLSEAIIQQAAQRLNEAEKTGTQISQFSLAYPEITIEDAYEIQKAWVAMKIAEGRVLKGH
KIGLTSKAMQNSSQINEPDYGALLDDMFFEENSEIPFDRFIVPRVEVELAFILKKDLSGP
NCTIFDVLDATDYVIPALEIIDARIEQFDSKTKVPRRVFDTISDNAANAGVVLGGRAIKP
MDVDLRRVAAVLYRNGVVEESGVSAAVLNNPIKGVAWLANKLHPYGVTLKAGEVILGGSF
TRPVAARRGDTFHVDYHELGSISMQFV
Download sequence
Identical sequences A0A1E3XHR1 Q9CKS2
gi|383311390|ref|YP_005364200.1| gi|386835408|ref|YP_006240726.1| gi|15603399|ref|NP_246473.1| WP_005724348.1.11014 WP_005724348.1.11214 WP_005724348.1.11947 WP_005724348.1.12156 WP_005724348.1.12311 WP_005724348.1.14908 WP_005724348.1.15732 WP_005724348.1.17980 WP_005724348.1.19996 WP_005724348.1.21657 WP_005724348.1.24757 WP_005724348.1.26777 WP_005724348.1.27592 WP_005724348.1.28084 WP_005724348.1.35562 WP_005724348.1.36022 WP_005724348.1.3807 WP_005724348.1.38246 WP_005724348.1.3839 WP_005724348.1.3957 WP_005724348.1.40210 WP_005724348.1.40787 WP_005724348.1.41297 WP_005724348.1.41351 WP_005724348.1.41657 WP_005724348.1.41667 WP_005724348.1.4211 WP_005724348.1.42469 WP_005724348.1.42512 WP_005724348.1.43687 WP_005724348.1.45422 WP_005724348.1.4808 WP_005724348.1.49053 WP_005724348.1.51342 WP_005724348.1.52585 WP_005724348.1.52859 WP_005724348.1.53852 WP_005724348.1.55074 WP_005724348.1.55401 WP_005724348.1.57956 WP_005724348.1.58111 WP_005724348.1.58257 WP_005724348.1.60478 WP_005724348.1.61098 WP_005724348.1.6219 WP_005724348.1.62389 WP_005724348.1.6332 WP_005724348.1.63549 WP_005724348.1.66990 WP_005724348.1.70689 WP_005724348.1.72215 WP_005724348.1.78987 WP_005724348.1.79347 WP_005724348.1.79593 WP_005724348.1.81885 WP_005724348.1.8281 WP_005724348.1.83579 WP_005724348.1.88402 WP_005724348.1.89773 WP_005724348.1.90578 WP_005724348.1.92478 WP_005724348.1.93940 WP_005724348.1.94432 WP_005724348.1.95718 WP_005724348.1.9746 272843.PM1534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]