SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603403|ref|NP_246477.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603403|ref|NP_246477.1|
Domain Number 1 Region: 226-433
Classification Level Classification E-value
Superfamily DNA methylase specificity domain 1.8e-40
Family Type I restriction modification DNA specificity domain 0.0000846
Further Details:      
 
Domain Number 2 Region: 2-171
Classification Level Classification E-value
Superfamily DNA methylase specificity domain 8.5e-32
Family Type I restriction modification DNA specificity domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603403|ref|NP_246477.1|
Sequence length 435
Comment protein HsdA [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MEDIVNFLNAKRKPLSAKERENRKGIYPYYGASDIVDYIDDYIFDGRYLLISEDGENLKT
RKTPIAFIAEGKFWVNNHAHIISGKDDQTIDYLKYYFSNFDLMPFLTGAVQPKLSKGILE
KIEIDFPCYEKRKRVNQFLGSLDNKIDLNTQTNQTLEQIAQAIFKSWFVDFDPVKAKVDV
LANGGSQADAERAAMQVISGKTDAELTQMQQTQPDAYKTLEKNTALFPSEMVESELGNVP
KGWGVSTIGDSVQTVGGATPSTTNEEFWSNGHIHWTTPKDLSSAKDKILLNTDRKITEAG
LKKISSGLLPINTVLLSSRAPVGYLALTRIPVAINQGYIGIICSDKLSCYYVLQWCQANL
DEIKGRASGTTFAEINKKTFREMRVLIPNNELIKVYDLQVEKLYKKITENIIESKALENI
RDALLPKLLSGELHI
Download sequence
Identical sequences Q9CKR8
gi|15603403|ref|NP_246477.1| 272843.PM1538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]