SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603412|ref|NP_246486.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603412|ref|NP_246486.1|
Domain Number 1 Region: 7-235
Classification Level Classification E-value
Superfamily Hsp33 domain 8.37e-75
Family Hsp33 domain 0.000000124
Further Details:      
 
Domain Number 2 Region: 227-284
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.00000000000000536
Family HSP33 redox switch-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603412|ref|NP_246486.1|
Sequence length 288
Comment Hsp33-like chaperonin [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTDNTDNDKLYRYLFQDRAVRGEWVRLNQTFTDTLNTHQYPKVIQNLLGEMMVATSLLTA
TLKFEGDITVQVQGDGPLKLALVNGNHQQQIRALARLQADVSDDMSLAQLVGKGVLVITI
APTEGERYQGVIALDKPTITACLEDYFVRSEQLQTQLIIRAGEFEGQPVAAGMLLQIMPD
GSGSPEDFEHLATLAATVKEEELFGLTAEELLYRLYHEERVEIFPSQPISFFCGCSQERS
GAALLLISDEELDEVLAEHNGTIDMQCECCGTHYFFNKAAIMQLKVEK
Download sequence
Identical sequences A0A126QET0 A0A2K2YU58 Q9CKQ9 V4NBQ1
WP_005718232.1.10027 WP_005718232.1.10721 WP_005718232.1.11014 WP_005718232.1.12311 WP_005718232.1.1307 WP_005718232.1.14908 WP_005718232.1.15732 WP_005718232.1.17217 WP_005718232.1.17980 WP_005718232.1.18123 WP_005718232.1.19996 WP_005718232.1.20287 WP_005718232.1.21657 WP_005718232.1.22153 WP_005718232.1.2313 WP_005718232.1.23830 WP_005718232.1.24757 WP_005718232.1.26616 WP_005718232.1.26777 WP_005718232.1.27416 WP_005718232.1.27664 WP_005718232.1.29697 WP_005718232.1.30617 WP_005718232.1.34253 WP_005718232.1.35978 WP_005718232.1.39152 WP_005718232.1.3957 WP_005718232.1.40210 WP_005718232.1.40787 WP_005718232.1.41462 WP_005718232.1.42469 WP_005718232.1.42943 WP_005718232.1.44741 WP_005718232.1.45422 WP_005718232.1.47685 WP_005718232.1.4808 WP_005718232.1.50853 WP_005718232.1.51342 WP_005718232.1.52066 WP_005718232.1.53852 WP_005718232.1.55074 WP_005718232.1.57420 WP_005718232.1.58450 WP_005718232.1.58628 WP_005718232.1.58910 WP_005718232.1.59455 WP_005718232.1.60664 WP_005718232.1.61098 WP_005718232.1.61860 WP_005718232.1.62016 WP_005718232.1.6219 WP_005718232.1.62389 WP_005718232.1.65482 WP_005718232.1.65878 WP_005718232.1.66934 WP_005718232.1.66990 WP_005718232.1.73917 WP_005718232.1.74955 WP_005718232.1.75804 WP_005718232.1.80223 WP_005718232.1.80589 WP_005718232.1.80911 WP_005718232.1.81885 WP_005718232.1.8281 WP_005718232.1.86541 WP_005718232.1.87897 WP_005718232.1.89773 WP_005718232.1.90081 WP_005718232.1.90179 WP_005718232.1.90578 WP_005718232.1.91495 WP_005718232.1.94435 WP_005718232.1.9746 WP_005718232.1.9947 gi|378775397|ref|YP_005177640.1| 272843.PM1547 gi|15603412|ref|NP_246486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]