SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603413|ref|NP_246487.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603413|ref|NP_246487.1|
Domain Number 1 Region: 8-271
Classification Level Classification E-value
Superfamily Carbohydrate phosphatase 4.97e-66
Family Inositol monophosphatase/fructose-1,6-bisphosphatase-like 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603413|ref|NP_246487.1|
Sequence length 275
Comment protein CysQ [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLALSPSLLEKTLEIADQAGDFLTRFYTDSGQNALAIQTKQDNTPVTAVDLFLSQFLIEK
LTSLTPEVPILSEESCKIPLQDRAHWAEYWLIDPLDGTQQFINRTDQFSILITLVQHNQP
VLSITHAPILQTTYYAMQGFGAYRRQGNQQEKLNNQARPEQRKIKIAVGVGGVERKIQPL
LNPAYQYEFLVYGSSGLKGGLVADGTCDCYIRVGKTGEWDTGAAEILLREMGGAVFDFAF
QPLSYNQRESFINPNFVMVANTEFDWQKIFQFHSH
Download sequence
Identical sequences Q9CKQ8
WP_010907222.1.12311 WP_010907222.1.15732 WP_010907222.1.40210 WP_010907222.1.45422 WP_010907222.1.4808 WP_010907222.1.53852 WP_010907222.1.6219 WP_010907222.1.62389 WP_010907222.1.66990 WP_010907222.1.81885 WP_010907222.1.8281 WP_010907222.1.89773 WP_010907222.1.9746 WP_010907222.1.9947 gi|15603413|ref|NP_246487.1| 272843.PM1548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]