SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603414|ref|NP_246488.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603414|ref|NP_246488.1|
Domain Number 1 Region: 181-487
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.86e-112
Family Glucose 6-phosphate dehydrogenase-like 0.000000398
Further Details:      
 
Domain Number 2 Region: 5-194
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.2e-60
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603414|ref|NP_246488.1|
Sequence length 496
Comment glucose-6-phosphate 1-dehydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKIEADNNCIVIFGASGDLTYRKLIPALYNLYKIGRLTEHFSVLGVARTELSDEGFREKM
RQALIKSEKANGETLDQFCSHLYYQALNTADAADYGKLIPRLDDLHDKYQTCGNTLYYLS
TPPSLYGVIPECLAAHGLNTEEFGWKRLIVEKPFGYDIRTAKELDIQIHRFFDEHQIYRI
DHYLGKETVQNLLVLRFSNGWFEPLWNRNFIDYIEITGAESIGVEERGGYYDDSGAMRDM
FQNHLLQVLAMVAMEPPAIINADSMRDEVAKVLYCLHPLSEDDLENHLVLGQYTAGTVEG
EAVKGYLQEKGVPAESNTETYMALRCEIDNWRWAGVPFYVRTGKRLPSRVTEIVIHFKTT
PHPVFSQKAPENKLIIRIQPDEAISMRFGLKKPGAGFEAKEVSMDFRYADLASPSLLTAY
ERLLLDSMKGDATLFARTDAVHACWQFVEPILQYKAQNGRVYEYEAGTWGPTEADKLIAK
TGRVWRKPSGLMKKKV
Download sequence
Identical sequences A0A1D7R539 Q9CKQ7 V4MT77
WP_005718235.1.10027 WP_005718235.1.10721 WP_005718235.1.12311 WP_005718235.1.1307 WP_005718235.1.14908 WP_005718235.1.15732 WP_005718235.1.17217 WP_005718235.1.17980 WP_005718235.1.18123 WP_005718235.1.19996 WP_005718235.1.20287 WP_005718235.1.22153 WP_005718235.1.2313 WP_005718235.1.23830 WP_005718235.1.24757 WP_005718235.1.26616 WP_005718235.1.26777 WP_005718235.1.27416 WP_005718235.1.29697 WP_005718235.1.30617 WP_005718235.1.34253 WP_005718235.1.35978 WP_005718235.1.36022 WP_005718235.1.39152 WP_005718235.1.3957 WP_005718235.1.40210 WP_005718235.1.40787 WP_005718235.1.41462 WP_005718235.1.42943 WP_005718235.1.44741 WP_005718235.1.45422 WP_005718235.1.47685 WP_005718235.1.4808 WP_005718235.1.50853 WP_005718235.1.52066 WP_005718235.1.53852 WP_005718235.1.55074 WP_005718235.1.57420 WP_005718235.1.58450 WP_005718235.1.58628 WP_005718235.1.58910 WP_005718235.1.59455 WP_005718235.1.60664 WP_005718235.1.61098 WP_005718235.1.61860 WP_005718235.1.62016 WP_005718235.1.6219 WP_005718235.1.62389 WP_005718235.1.65482 WP_005718235.1.65878 WP_005718235.1.66934 WP_005718235.1.66990 WP_005718235.1.70689 WP_005718235.1.73917 WP_005718235.1.74955 WP_005718235.1.75804 WP_005718235.1.79593 WP_005718235.1.80223 WP_005718235.1.80589 WP_005718235.1.80911 WP_005718235.1.81885 WP_005718235.1.8281 WP_005718235.1.86541 WP_005718235.1.87897 WP_005718235.1.89773 WP_005718235.1.90081 WP_005718235.1.90179 WP_005718235.1.91495 WP_005718235.1.94435 WP_005718235.1.95718 WP_005718235.1.9746 WP_005718235.1.9947 272843.PM1549 gi|15603414|ref|NP_246488.1| gi|378775399|ref|YP_005177642.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]