SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603425|ref|NP_246499.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603425|ref|NP_246499.1|
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily Formyltransferase 1.44e-67
Family Formyltransferase 0.000000176
Further Details:      
 
Domain Number 2 Region: 207-313
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 7.06e-30
Family Post formyltransferase domain 0.0000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603425|ref|NP_246499.1|
Sequence length 317
Comment methionyl-tRNA formyltransferase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTSLKIIFAGTPAFAAQHLQALLNSHHQVVAVYTQPDKPAGRGKKLQASPVKQLAEQHNI
PVYQPKSLRKVEAQEEMRAIDADVMVVVAYGLILPQTVLAMPRLGCLNVHGSLLPRWRGA
APIQRAIWAGDKQTGITIMQMDEGLDTGDMLYKVYCDIAQDETSTSLYAKLMEIAPPALL
HVLDGLDKGKFVSEKQDDIESCYAEKLSKEEAELNWHVSAEQLERHIRAFNPWPVSYFST
RDLQGNTQVIKVYKAAVLPHVDKVAGTILSADKNGIQIATAEGVLNLLQLQPAGKKPMDA
RDLLNGRAEWFPVGKVL
Download sequence
Identical sequences A0A126QH58 A0A2K2YUI2 P57949 V4N9D6
gi|386835434|ref|YP_006240753.1| gi|15603425|ref|NP_246499.1| 272843.PM1560 gi|383311411|ref|YP_005364221.1| WP_010907230.1.10027 WP_010907230.1.10721 WP_010907230.1.12311 WP_010907230.1.1307 WP_010907230.1.15732 WP_010907230.1.17217 WP_010907230.1.17980 WP_010907230.1.18123 WP_010907230.1.20287 WP_010907230.1.22153 WP_010907230.1.2313 WP_010907230.1.23830 WP_010907230.1.26616 WP_010907230.1.26777 WP_010907230.1.27416 WP_010907230.1.27592 WP_010907230.1.27664 WP_010907230.1.29697 WP_010907230.1.30617 WP_010907230.1.34253 WP_010907230.1.35978 WP_010907230.1.36022 WP_010907230.1.39152 WP_010907230.1.40210 WP_010907230.1.41297 WP_010907230.1.41462 WP_010907230.1.41657 WP_010907230.1.42512 WP_010907230.1.42943 WP_010907230.1.44741 WP_010907230.1.45422 WP_010907230.1.47685 WP_010907230.1.4808 WP_010907230.1.50853 WP_010907230.1.52066 WP_010907230.1.53852 WP_010907230.1.55074 WP_010907230.1.57420 WP_010907230.1.57956 WP_010907230.1.58450 WP_010907230.1.58628 WP_010907230.1.58910 WP_010907230.1.59455 WP_010907230.1.60664 WP_010907230.1.61860 WP_010907230.1.62016 WP_010907230.1.6219 WP_010907230.1.62389 WP_010907230.1.65482 WP_010907230.1.65878 WP_010907230.1.66934 WP_010907230.1.66990 WP_010907230.1.73917 WP_010907230.1.74955 WP_010907230.1.75804 WP_010907230.1.79593 WP_010907230.1.80223 WP_010907230.1.80589 WP_010907230.1.80911 WP_010907230.1.81885 WP_010907230.1.8281 WP_010907230.1.86541 WP_010907230.1.87897 WP_010907230.1.89773 WP_010907230.1.90081 WP_010907230.1.90179 WP_010907230.1.91495 WP_010907230.1.94432 WP_010907230.1.94435 WP_010907230.1.9746 WP_010907230.1.9947 gi|378775410|ref|YP_005177653.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]