SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603428|ref|NP_246502.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603428|ref|NP_246502.1|
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.27e-33
Family Potassium channel NAD-binding domain 0.0012
Further Details:      
 
Domain Number 2 Region: 232-376
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.06e-30
Family Potassium channel NAD-binding domain 0.0028
Further Details:      
 
Domain Number 3 Region: 147-226
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.000000000405
Family TrkA C-terminal domain-like 0.011
Further Details:      
 
Domain Number 4 Region: 367-440
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.0000000772
Family TrkA C-terminal domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603428|ref|NP_246502.1|
Sequence length 458
Comment potassium transporter peripheral membrane protein [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKIIILGAGQVGKTLAENLVSEDNDITLVDNQSLRLENLQSKHDLRVVNGSASSPRVLRE
AGAQDADLLVAVTSSDEINMVACQISYTLFNTPTKIARIRNAEYLREKDKLFQTNVLPID
HIISPEKLVTDEITRLIDYPGALQVAHFANGRISLVVVKAYYGGPLVGYAISALKDHMPH
IECRIVSILRQDKVIRPQGSTIIEAGDEITFICETIHIKAVMSELQRLEKPYKRIMIAGG
GNVGIGVAKNLEGKCSVKLIERNAERATALAEKLSNTLIFCGDASDQSFLLEEQIENVDV
FLSLTSDDEANIMSALLAKRLGAKKALVLIQRMAYINLIQGGTIDIAVSPQQTTISALLS
HVRKGDTVNVASLRHGVAEALEIIVHGEESSSLVIGRKISELKLPQGAIVGAILRGNEVI
MAKKNLVIEDNDHVIVYLSDKKFVSDIEKLFQPSVFFI
Download sequence
Identical sequences A0A1E3XL89 Q9CKP5
WP_005724399.1.11014 WP_005724399.1.11214 WP_005724399.1.11947 WP_005724399.1.12156 WP_005724399.1.14908 WP_005724399.1.17980 WP_005724399.1.19996 WP_005724399.1.21657 WP_005724399.1.24757 WP_005724399.1.27592 WP_005724399.1.28084 WP_005724399.1.35562 WP_005724399.1.36022 WP_005724399.1.3807 WP_005724399.1.38246 WP_005724399.1.3839 WP_005724399.1.3957 WP_005724399.1.40210 WP_005724399.1.40787 WP_005724399.1.41297 WP_005724399.1.41351 WP_005724399.1.41657 WP_005724399.1.41667 WP_005724399.1.4211 WP_005724399.1.42469 WP_005724399.1.42512 WP_005724399.1.43687 WP_005724399.1.45422 WP_005724399.1.4808 WP_005724399.1.49053 WP_005724399.1.51342 WP_005724399.1.52585 WP_005724399.1.52859 WP_005724399.1.53852 WP_005724399.1.55074 WP_005724399.1.55401 WP_005724399.1.57956 WP_005724399.1.58111 WP_005724399.1.58257 WP_005724399.1.60478 WP_005724399.1.61098 WP_005724399.1.6219 WP_005724399.1.6332 WP_005724399.1.63549 WP_005724399.1.66990 WP_005724399.1.70689 WP_005724399.1.72215 WP_005724399.1.78987 WP_005724399.1.79347 WP_005724399.1.79593 WP_005724399.1.8281 WP_005724399.1.83579 WP_005724399.1.88402 WP_005724399.1.89773 WP_005724399.1.90578 WP_005724399.1.92478 WP_005724399.1.93940 WP_005724399.1.94432 WP_005724399.1.95718 WP_005724399.1.9746 WP_005724399.1.9947 272843.PM1563 gi|15603428|ref|NP_246502.1| gi|383311414|ref|YP_005364224.1| gi|386835438|ref|YP_006240757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]