SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603434|ref|NP_246508.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603434|ref|NP_246508.1|
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily Phosphotyrosine protein phosphatases I 1.18e-44
Family Low-molecular-weight phosphotyrosine protein phosphatases 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603434|ref|NP_246508.1|
Sequence length 156
Comment hypothetical protein PM1569 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTIHLLFVCLGNICRSPMAEFLMREKIKQAGLETVIKTSSAGTSGWHDGEDMHCGTADIL
DQCHIDSTGFRSKKVQRQHWQEFDYIIAMDNSNLQDLERLFGHHPDKLFKITELCPDLGY
DHIPDPWYSKDFNQTYQLLNPCCDALLARLREKHHL
Download sequence
Identical sequences Q9CKP0
272843.PM1569 gi|15603434|ref|NP_246508.1| WP_005724402.1.12311 WP_005724402.1.15732 WP_005724402.1.27592 WP_005724402.1.40210 WP_005724402.1.41351 WP_005724402.1.41657 WP_005724402.1.41667 WP_005724402.1.42512 WP_005724402.1.45422 WP_005724402.1.4808 WP_005724402.1.53852 WP_005724402.1.58111 WP_005724402.1.6219 WP_005724402.1.62389 WP_005724402.1.66990 WP_005724402.1.70689 WP_005724402.1.81885 WP_005724402.1.8281 WP_005724402.1.88402 WP_005724402.1.89773 WP_005724402.1.92478 WP_005724402.1.93940 WP_005724402.1.94432 WP_005724402.1.9746 WP_005724402.1.9947 gi|386835444|ref|YP_006240763.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]