SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603435|ref|NP_246509.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603435|ref|NP_246509.1|
Domain Number 1 Region: 1189-1299
Classification Level Classification E-value
Superfamily Pili subunits 7.69e-28
Family YadA C-terminal domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 601-797
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 1.29e-25
Family Adhesin YadA, collagen-binding domain 0.0012
Further Details:      
 
Domain Number 3 Region: 252-401
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 1.83e-18
Family Adhesin YadA, collagen-binding domain 0.0014
Further Details:      
 
Domain Number 4 Region: 85-235
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.00000000000000811
Family Adhesin YadA, collagen-binding domain 0.0018
Further Details:      
 
Domain Number 5 Region: 469-591
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.0000000615
Family Adhesin YadA, collagen-binding domain 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|15603435|ref|NP_246509.1|
Domain Number - Region: 852-958
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.000103
Family Adhesin YadA, collagen-binding domain 0.015
Further Details:      
 
Domain Number - Region: 1058-1201
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.00128
Family Adhesin YadA, collagen-binding domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603435|ref|NP_246509.1|
Sequence length 1299
Comment hypothetical protein PM1570 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNKIYRTLWNAATQSWVVVSELAKAGGKSASGKSALVNSVSGFSFTLIAASVVLGSGQVN
AAEVTGNTGVSGDDKYCFYNASSQSVICGDATTKTTDKTDNKPAKSVVIGFGATNDGETN
VAIGAKSKSSKAASIAIGDNAKALDNQAIAIGQNATANSDWDISIGRQAGAEQTEVSAEG
RNIAIGDGALKRGKGVNNNIALGTSAGDRLAGTHNVLMGTYVNADEAVRSALTAGSTTKE
INAKETTDNKYYIEASNTVALGTRALATQLAAVAIGQQAKAFGNQSVAVGNGTKASGQTA
IATGSNAHATGSSSIAIGGTVNGNDTARTLASDNFTIAMGLSAQATKSDAIAVGRNAKAA
GINTVSIGYNAGVTKTADEAQSDPNNKLEPATDAVFIGNKAGYKSNQNRMQVSLGKDSGE
GVVGTENVTIGNSAGKNTKGNTNVAISSRAGQNVEGHDNFAALIEAGQNIKGSDNIAIGK
HAGRSADPNTKLNINNTISLGKESVSLKNFGIAQGNKAKTDGLASIAIGRNAEAVGGETA
NIAIGDSASADASGAIVLGTKAQAKSLTVDGKKYGAYSAIVIGTEAKAIAQAAPAGKNEN
PKDAIAIGTKAEAHYASTIALGFGAKSDTKAQAVSIGYNSNAKGYQAIAFGSEAKTTENA
GSSIAFGTKAQTRASASIAIGMGAETGFDGGQALDGSDAVALGREAKAKRQNALAFGYKA
VADHKDAVALGAGAETAAAEGTNEATVNEFKYSGFAGIKPIATVSVGKKDAERTITNVAA
GRIDKTSTDAINGSQLYLALNALGNVGNTLVTNVLGGDAAIVKEGDEAGTLTMSNIGGTG
KGTIHDAIEAVNNTAKASKTTVKEGDNITVTEEAAADGSRTYTVATKKDVKFDSVVAGGT
KIDANGLTFVDDQGTKIDNTPSISKTGIDAGNQKVTNVQNGNIAKDSKDAVNGGQLFAQG
EGVKNIIGGDTTYNPETGEYANTNIGGTGASTIDEAIKAVNTTAKAAKTEVVQGENIVVT
SAPGANGNTVYTVATAKEVTFDKTTVGSVVTDKNTNDITGLSNKTLGGDNFAKNGRAASE
EQLNATQTNLATLLGGNAQNTNGNVAMTDIGGTGKNNINDAIKASRNEVKQGKNMVVTPT
TGANGQTIYEVATADKVAFDEVKVGGITIDATTNKISGIAKGDISENSTDAVNGSQLYEL
QQKIAKSGDNYNILNNRINKVDKDLRAGIAGANAAAGLPQAYIPGKSMVAVAAGTYKGQN
AIALGMSRISDNGKVIIKLTGNTNSRGDFGASIGAGYQW
Download sequence
Identical sequences Q7DAX9 Q9F3X6
WP_010907233.1.12311 WP_010907233.1.15732 WP_010907233.1.40210 WP_010907233.1.45422 WP_010907233.1.4808 WP_010907233.1.53852 WP_010907233.1.6219 WP_010907233.1.62389 WP_010907233.1.66990 WP_010907233.1.81885 WP_010907233.1.8281 WP_010907233.1.89773 WP_010907233.1.9746 gi|15603435|ref|NP_246509.1| 272843.PM1570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]