SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603436|ref|NP_246510.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603436|ref|NP_246510.1|
Domain Number 1 Region: 117-372
Classification Level Classification E-value
Superfamily Radical SAM enzymes 4.32e-52
Family MoCo biosynthesis proteins 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603436|ref|NP_246510.1|
Sequence length 446
Comment ribosomal protein S12 methylthiotransferase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTSSLPNIGFISLGCPKNLVDSERILTELRSDGYNIIPSYENADLVIVNTCGFIDSAVQE
SLEAIGEALEENGKVIVTGCLGAKEDRIREVHPKVLEVTGPHSYEAVMQQVHKYVPKPAY
NPYVNLVPKQGVKLTPKHYAYLKISEGCDHRCTFCIIPSMRGDLDSRSITQVLDEAKRLV
EAGVKEILVVSQDTSAYALDRSKEEQNKTVFWNGMPIKNNLISLCEQLGKLGVWVRLHYV
YPYPHVDQLIPLMAEGKILPYLDIPLQHASPKILKAMKRPGSIERTLERIKKWREICPDL
TLRSTFIVGFPGESEEDFQLLLDFLKEALLDRVGCFKFSPVEGAIATEMPDQVPEEVKEA
RFHRFMQLQQEISAARLQQKVGKVFTVLVDEVDEEGIIARSIADAPEIDGVVYIDNPNRV
AVKAGQFIEVKITRADAYDLYASLIN
Download sequence
Identical sequences Q9CKN9
272843.PM1571 gi|15603436|ref|NP_246510.1| WP_010907234.1.12311 WP_010907234.1.15732 WP_010907234.1.40210 WP_010907234.1.45422 WP_010907234.1.4808 WP_010907234.1.53852 WP_010907234.1.6219 WP_010907234.1.62389 WP_010907234.1.66990 WP_010907234.1.81885 WP_010907234.1.8281 WP_010907234.1.89773 WP_010907234.1.9746 WP_010907234.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]