SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603443|ref|NP_246517.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603443|ref|NP_246517.1|
Domain Number 1 Region: 52-336
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.55e-72
Family Phosphate binding protein-like 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603443|ref|NP_246517.1|
Sequence length 339
Comment hypothetical protein PM1578 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKMKFTLSIAATALFALSLSACDDKKTATVSTASSNNPTTAAETPVSVQSKFVTIATGG
ASGPYNIIATTLSDIYSKSLKTNSKTQTTGASVENLNLMAQKKVEMAFVMSDALNDALNG
TGSFPAKLENVTQMAALYPNYVQIVTSKRSGIKTITDLKGKRVATGAQNSGVEVNARNLL
AGFGITYSDINVDYLGYAEAADALKAGSIDAAFLTSGLPNSSLLELQQSFDLQLVAIPVE
GVQKLAESKPYFNAMEIPANTYGNEEPIPTAAIKNALVVRKDMSEADVYLLTKTFFDSLA
QLQTAHQAAKAVSLEGAQQGLVAPLHPGAQKYYDEVSKK
Download sequence
Identical sequences A0A1D2NZB3 A0A2K2YU45 J4SHF4 Q9CKN3
gi|15603443|ref|NP_246517.1| 272843.PM1578 WP_005735695.1.11014 WP_005735695.1.12156 WP_005735695.1.12311 WP_005735695.1.15732 WP_005735695.1.19996 WP_005735695.1.24757 WP_005735695.1.26777 WP_005735695.1.27592 WP_005735695.1.27664 WP_005735695.1.36022 WP_005735695.1.38246 WP_005735695.1.3839 WP_005735695.1.40210 WP_005735695.1.40787 WP_005735695.1.41657 WP_005735695.1.42469 WP_005735695.1.42512 WP_005735695.1.45422 WP_005735695.1.4808 WP_005735695.1.49053 WP_005735695.1.52585 WP_005735695.1.52859 WP_005735695.1.53852 WP_005735695.1.55074 WP_005735695.1.55401 WP_005735695.1.58257 WP_005735695.1.6219 WP_005735695.1.62389 WP_005735695.1.66990 WP_005735695.1.79347 WP_005735695.1.81885 WP_005735695.1.8281 WP_005735695.1.83579 WP_005735695.1.89773 WP_005735695.1.90578 WP_005735695.1.94432 WP_005735695.1.95718 WP_005735695.1.9746 WP_005735695.1.9947 gi|386835456|ref|YP_006240775.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]