SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603449|ref|NP_246523.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603449|ref|NP_246523.1|
Domain Number 1 Region: 11-122
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 3.14e-40
Family Sigma2 domain of RNA polymerase sigma factors 0.00085
Further Details:      
 
Domain Number 2 Region: 194-278
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 2.24e-17
Family Sigma4 domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603449|ref|NP_246523.1|
Sequence length 281
Comment RNA polymerase factor sigma-32 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNKDTQTMMLVPQGSIEAYIRAANEYPMLTAEEEKELAERLYYQEDLEAAKKLILSHLRF
VIHVARGYSGYGLPQADLIQEGNIGLMKAVKRFNPEVGVRLVSFAVHWIKAEIHEYVLRN
WRIVKVATTKAQRKLFFNLRKTKQRLGWFNENEVEMVANELGVSPADVMEMESRMTGADV
AFDLPTDDNEETYSPSLYLEDKGSNFAAELENENYEAQATEQLSVALEGLDERSLDIIKA
RWLDENKATLQDLAAKYNISAERVRQLETNALKKLKSAVNF
Download sequence
Identical sequences A0A1E3XI40 Q9CKM7 V4NH11
WP_005724428.1.10027 WP_005724428.1.10721 WP_005724428.1.11014 WP_005724428.1.12311 WP_005724428.1.1307 WP_005724428.1.15732 WP_005724428.1.17217 WP_005724428.1.18123 WP_005724428.1.19996 WP_005724428.1.20287 WP_005724428.1.22153 WP_005724428.1.2313 WP_005724428.1.23830 WP_005724428.1.24757 WP_005724428.1.26616 WP_005724428.1.27416 WP_005724428.1.29697 WP_005724428.1.30617 WP_005724428.1.34253 WP_005724428.1.35978 WP_005724428.1.36022 WP_005724428.1.39152 WP_005724428.1.40210 WP_005724428.1.40787 WP_005724428.1.41351 WP_005724428.1.41462 WP_005724428.1.41667 WP_005724428.1.4211 WP_005724428.1.42469 WP_005724428.1.42943 WP_005724428.1.44741 WP_005724428.1.45422 WP_005724428.1.47685 WP_005724428.1.4808 WP_005724428.1.50853 WP_005724428.1.52066 WP_005724428.1.53852 WP_005724428.1.57420 WP_005724428.1.58111 WP_005724428.1.58450 WP_005724428.1.58628 WP_005724428.1.58910 WP_005724428.1.59455 WP_005724428.1.60664 WP_005724428.1.61860 WP_005724428.1.62016 WP_005724428.1.6219 WP_005724428.1.62389 WP_005724428.1.65482 WP_005724428.1.65878 WP_005724428.1.66934 WP_005724428.1.66990 WP_005724428.1.70689 WP_005724428.1.73917 WP_005724428.1.74955 WP_005724428.1.75804 WP_005724428.1.79593 WP_005724428.1.80223 WP_005724428.1.80589 WP_005724428.1.80911 WP_005724428.1.81885 WP_005724428.1.8281 WP_005724428.1.86541 WP_005724428.1.87897 WP_005724428.1.88402 WP_005724428.1.89773 WP_005724428.1.90081 WP_005724428.1.90179 WP_005724428.1.90578 WP_005724428.1.91495 WP_005724428.1.92478 WP_005724428.1.93940 WP_005724428.1.94435 WP_005724428.1.95718 WP_005724428.1.9746 WP_005724428.1.9947 272843.PM1584 gi|378775436|ref|YP_005177679.1| gi|15603449|ref|NP_246523.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]