SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603471|ref|NP_246545.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603471|ref|NP_246545.1|
Domain Number 1 Region: 5-415
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 7.87e-141
Family Dimeric isocitrate & isopropylmalate dehydrogenases 0.0000000000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603471|ref|NP_246545.1|
Sequence length 415
Comment hypothetical protein PM1606 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQSKVVIPQGEKIQLDAKGALIVPDHPIIPFIEGDGIGVDVTPAMRTVIDAAVEKAYGGK
RKISWMEIYAGGKANEVYGENTWLPDETMTFIRDYHVAIKGPLMTPVGGGIRSLNVAMRQ
GLDLYNCLRPIRYYDGTPSPVKHPELVDMVIFRENSEDIYAGVEWVAGSAEANKVIAFLQ
QEMGVKKIRFTEDCGIGIKPVSKQGTQRLVRAALQYVIDNDRKSLTLVHKGNIMKFTEGA
FKEWGYQVAQEFGAELLDGGPWMTLKNPKTGREIIIKDSIADAFLQEILLHPTEYDVIAT
LNLNGDYISDALAAQVGGIGISPGANIGAEAAIFEATHGTAPKIAGQDKGNPGSLILSGE
MMLRHLGWLEAADLVVKAVSKTIADKTVTFDFAEMLEGAKLRSTSEFAQDIVANM
Download sequence
Identical sequences A0A2J9QW41 Q9CKK6
WP_010907250.1.12311 WP_010907250.1.15732 WP_010907250.1.19996 WP_010907250.1.26777 WP_010907250.1.36022 WP_010907250.1.40210 WP_010907250.1.45422 WP_010907250.1.4808 WP_010907250.1.53852 WP_010907250.1.6219 WP_010907250.1.62389 WP_010907250.1.66990 WP_010907250.1.81885 WP_010907250.1.8281 WP_010907250.1.89773 WP_010907250.1.95718 WP_010907250.1.9746 WP_010907250.1.9947 gi|15603471|ref|NP_246545.1| 272843.PM1606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]