SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603480|ref|NP_246554.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603480|ref|NP_246554.1|
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily DTD-like 1.7e-54
Family DTD-like 0.000000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603480|ref|NP_246554.1|
Sequence length 144
Comment D-tyrosyl-tRNA(Tyr) deacylase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MIALIQRVSQAKVDVDKQTVGEIGHGLLVLLGVQKDDDHVKADRLIEKVLNYRVFSDAEG
KMNLNVQQVKGQVLVVSQFTLAADTQKGLRPSFSRGASPDMAEALYDYVVKKCGEKIPTF
SGQFAADMQVSLTNDGPVTFWLEI
Download sequence
Identical sequences A0A1D7R4W8 Q9CKK0 V4MT30
WP_005724478.1.10027 WP_005724478.1.10721 WP_005724478.1.12311 WP_005724478.1.1307 WP_005724478.1.15732 WP_005724478.1.17217 WP_005724478.1.18123 WP_005724478.1.19996 WP_005724478.1.20287 WP_005724478.1.21657 WP_005724478.1.22153 WP_005724478.1.2313 WP_005724478.1.23830 WP_005724478.1.24757 WP_005724478.1.26616 WP_005724478.1.26777 WP_005724478.1.27416 WP_005724478.1.27592 WP_005724478.1.29697 WP_005724478.1.30617 WP_005724478.1.34253 WP_005724478.1.35978 WP_005724478.1.36022 WP_005724478.1.39152 WP_005724478.1.40210 WP_005724478.1.40787 WP_005724478.1.41297 WP_005724478.1.41462 WP_005724478.1.41657 WP_005724478.1.42512 WP_005724478.1.42943 WP_005724478.1.44741 WP_005724478.1.45422 WP_005724478.1.47685 WP_005724478.1.4808 WP_005724478.1.49053 WP_005724478.1.50853 WP_005724478.1.51342 WP_005724478.1.52066 WP_005724478.1.53852 WP_005724478.1.55074 WP_005724478.1.57420 WP_005724478.1.57956 WP_005724478.1.58450 WP_005724478.1.58628 WP_005724478.1.58910 WP_005724478.1.59455 WP_005724478.1.60664 WP_005724478.1.61860 WP_005724478.1.62016 WP_005724478.1.6219 WP_005724478.1.62389 WP_005724478.1.65482 WP_005724478.1.65878 WP_005724478.1.66934 WP_005724478.1.66990 WP_005724478.1.70689 WP_005724478.1.73917 WP_005724478.1.74955 WP_005724478.1.75804 WP_005724478.1.80223 WP_005724478.1.80589 WP_005724478.1.80911 WP_005724478.1.81885 WP_005724478.1.8281 WP_005724478.1.86541 WP_005724478.1.87897 WP_005724478.1.89773 WP_005724478.1.90081 WP_005724478.1.90179 WP_005724478.1.91495 WP_005724478.1.94432 WP_005724478.1.94435 WP_005724478.1.95718 WP_005724478.1.9746 WP_005724478.1.9947 gi|378775468|ref|YP_005177711.1| gi|386835494|ref|YP_006240813.1| gi|15603480|ref|NP_246554.1| gi|383311470|ref|YP_005364280.1| 272843.PM1615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]