SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603490|ref|NP_246564.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603490|ref|NP_246564.1|
Domain Number 1 Region: 3-420
Classification Level Classification E-value
Superfamily IlvD/EDD N-terminal domain-like 1.83e-135
Family lvD/EDD N-terminal domain-like 0.0000132
Further Details:      
 
Domain Number 2 Region: 421-608
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.18e-60
Family IlvD/EDD C-terminal domain-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603490|ref|NP_246564.1|
Sequence length 611
Comment dihydroxy-acid dehydratase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MPKLRSATSTQGRNMAGARALWRATGMKENDFGKPIIAVVNSFTQFVPGHVHLKDMGQLV
AREIEKAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRDLIADSVEYMVNAHCADAMVCIS
NCDKITPGMLMAALRLNIPCVFVSGGPMEAGKTKLSDKIIKLDLVDAMIQGANPNVSDED
SAQIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSCLATHADRKQLFLDAGKQVV
ELCKRYYEQEDDSVLPRSIANKKAFENAMSLDIAMGGSTNTVLHLLAAAQEAEVDFTMAD
IDRLSRQVPCLSKVAPNTQKYHMEDVHRAGGIMAILGELDRANLLHNDTRTVLGMSLAEQ
IAKYDIVLTKDEAVHKFFRAGPAGIRTTEAFSQDCRWDTVDDDRENGCIRSKTFAYSQDG
GLAMLSGNLAMDGCIVKTAGVDESILKFTGDAIVFESQEDAVAGILGGKVQAGHVVVIRY
EGPKGGPGMQEMLYPTSYLKSMGLGKACALLTDGRFSGGTSGLSIGHCSPEAAAGGLIGL
VKDGDKIEIDIPNRSIQLCVAEEELAQRRAEQDKLGWQPVNRQREVSFALKVYGHFATSA
DKGAVRDKTKI
Download sequence
Identical sequences P57957
WP_005757827.1.11014 WP_005757827.1.12311 WP_005757827.1.15732 WP_005757827.1.17980 WP_005757827.1.19996 WP_005757827.1.21657 WP_005757827.1.40210 WP_005757827.1.42469 WP_005757827.1.45422 WP_005757827.1.4808 WP_005757827.1.51342 WP_005757827.1.53852 WP_005757827.1.6219 WP_005757827.1.62389 WP_005757827.1.66990 WP_005757827.1.79593 WP_005757827.1.81885 WP_005757827.1.8281 WP_005757827.1.89773 WP_005757827.1.90578 WP_005757827.1.9746 WP_005757827.1.9947 gi|15603490|ref|NP_246564.1| 272843.PM1625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]