SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603493|ref|NP_246567.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603493|ref|NP_246567.1|
Domain Number 1 Region: 354-546
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.07e-62
Family Pyruvate oxidase and decarboxylase PP module 0.0000169
Further Details:      
 
Domain Number 2 Region: 1-173
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.66e-62
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000451
Further Details:      
 
Domain Number 3 Region: 182-342
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2e-56
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603493|ref|NP_246567.1|
Sequence length 549
Comment acetolactate synthase 2 catalytic subunit [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNGARLVTESLKTHGVTTVFGYPGGAIMPVYDALYDAGIEHLLCRNEQGAAMAAIGYARS
SGKVGVCIATSGPGAANLITGLGDALMDSIPVVAITGQVASPLIGTDAFQEADVLGLSLA
CTKHSFLVQSIEELPDVIAKAFEIAASGRPGPVLIDIPKDIQIAPTDVTPFTYSVAKPTA
LSQAHLTDALTLLKQAKRPVLYVGGGVGMAQAVPALREFLAVTQMPSVSTLKGLGSVHPD
NPYYMGMIGMHGTKAANYAVQECDLLLAFGARFDDRVTGKLDTFAPHAKVIHADIDMAEI
GKLRRPDVALCGDIVQAFNALSIPLNIAEWQAHIKQLKQTHDFCYSTNQGDTFINPLWLL
NSLSKKKPQSAVITTDVGQHQMWSAQHMQHYAPENYITSAGYGTMGFGLPAAIGAKKARP
DDEVILISGDGSIMMNIQELGTFKRGKTPVKIVLLDNQRLGMVRQWQELFFNARFSNTIL
DDNPDFVMLAAAFGIQGERITKGEEVEGALDRLLASKEAYFLHVCISSNENVWPLVPPNA
CNLDMVEQM
Download sequence
Identical sequences Q9CKI9
gi|15603493|ref|NP_246567.1| WP_010907261.1.12311 WP_010907261.1.15732 WP_010907261.1.19996 WP_010907261.1.26777 WP_010907261.1.40210 WP_010907261.1.45422 WP_010907261.1.4808 WP_010907261.1.53852 WP_010907261.1.6219 WP_010907261.1.62389 WP_010907261.1.66990 WP_010907261.1.81885 WP_010907261.1.8281 WP_010907261.1.89773 WP_010907261.1.9746 WP_010907261.1.9947 272843.PM1628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]