SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603497|ref|NP_246571.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603497|ref|NP_246571.1|
Domain Number 1 Region: 135-355
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 4.17e-77
Family GAPDH-like 0.00000000465
Further Details:      
 
Domain Number 2 Region: 1-148
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.94e-56
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.000000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603497|ref|NP_246571.1|
Sequence length 369
Comment aspartate-semialdehyde dehydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQNVGFIGWRGMVGSVLMDRMQEENDFANINPVFFTTSQAGQNAPVFGGKQAGELKDAFD
IAELQKLDIIVTCQGGDYTNEVYPKLRAAGWKGYWIDAASALRMEKDAIIVLDPVNQNVI
SEGLKNGIKTYVGGNCTVSLMLMALGGLFERDLVEWVSVATYQAASGAGAKNMRELLVQM
GQLEDSVKVDLDNPASSILDIERKVTAKMRGDLPIENFGAPLAGSLIPWIDKLWEDGQTK
EEWKGYAETNKILGLDDSPIPVDGLCVRIGALRCHSQAFTIKMKKDLPLEEIEQILASHN
EWVKVIPNEKDVTLRELTPTKVTGTLSVPVGRLRKLKMGPEYLAAFTVGDQLLWGAAEPL
RRILKQLVA
Download sequence
Identical sequences A0A1D7R516 A0A2K2YU30 Q9CKI5 V4NGW8
gi|15603497|ref|NP_246571.1| WP_005752172.1.10027 WP_005752172.1.10721 WP_005752172.1.11014 WP_005752172.1.11214 WP_005752172.1.11947 WP_005752172.1.12156 WP_005752172.1.12311 WP_005752172.1.1307 WP_005752172.1.14908 WP_005752172.1.15732 WP_005752172.1.17217 WP_005752172.1.18123 WP_005752172.1.19996 WP_005752172.1.20287 WP_005752172.1.21657 WP_005752172.1.22153 WP_005752172.1.2313 WP_005752172.1.23830 WP_005752172.1.26616 WP_005752172.1.27416 WP_005752172.1.27664 WP_005752172.1.28084 WP_005752172.1.29697 WP_005752172.1.30617 WP_005752172.1.34253 WP_005752172.1.35562 WP_005752172.1.35978 WP_005752172.1.3807 WP_005752172.1.38246 WP_005752172.1.3839 WP_005752172.1.39152 WP_005752172.1.3957 WP_005752172.1.40210 WP_005752172.1.41462 WP_005752172.1.42469 WP_005752172.1.42943 WP_005752172.1.43687 WP_005752172.1.44741 WP_005752172.1.45422 WP_005752172.1.47685 WP_005752172.1.4808 WP_005752172.1.50853 WP_005752172.1.51342 WP_005752172.1.52066 WP_005752172.1.52585 WP_005752172.1.52859 WP_005752172.1.53852 WP_005752172.1.55074 WP_005752172.1.55401 WP_005752172.1.57420 WP_005752172.1.58257 WP_005752172.1.58450 WP_005752172.1.58628 WP_005752172.1.58910 WP_005752172.1.59455 WP_005752172.1.60478 WP_005752172.1.60664 WP_005752172.1.61098 WP_005752172.1.61860 WP_005752172.1.62016 WP_005752172.1.6219 WP_005752172.1.62389 WP_005752172.1.6332 WP_005752172.1.63549 WP_005752172.1.65482 WP_005752172.1.65878 WP_005752172.1.66934 WP_005752172.1.66990 WP_005752172.1.72215 WP_005752172.1.73917 WP_005752172.1.74955 WP_005752172.1.75804 WP_005752172.1.78987 WP_005752172.1.79347 WP_005752172.1.80223 WP_005752172.1.80589 WP_005752172.1.80911 WP_005752172.1.81885 WP_005752172.1.8281 WP_005752172.1.83579 WP_005752172.1.86541 WP_005752172.1.87897 WP_005752172.1.89773 WP_005752172.1.90081 WP_005752172.1.90179 WP_005752172.1.90578 WP_005752172.1.91495 WP_005752172.1.94435 WP_005752172.1.9746 WP_005752172.1.9947 272843.PM1632 gi|378775485|ref|YP_005177728.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]