SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603506|ref|NP_246580.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603506|ref|NP_246580.1|
Domain Number 1 Region: 3-220
Classification Level Classification E-value
Superfamily Putative cyclase 8.37e-39
Family Putative cyclase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603506|ref|NP_246580.1|
Sequence length 223
Comment hypothetical protein PM1641 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSNWIDLSMPIANNHVRWQTHIEKKGNFDSGDLFEATQLQVSCHAFTHMDALSHIQKGAY
NILDISPDVYIGKFHVLDLSKQVTENLAITADVLDAIWPEGDVERIIFKTCWDQHHHYNT
VCFWTKSPYITEDGAKYLAEKKLKLITFDFPQDYPIRRWVDGIIEKPLSKHVTHQHLLMQ
GVTLVEYICNTHKITSHCVEGLMIPIAIEHADGAPCRVLVKNL
Download sequence
Identical sequences A0A1D7R4C3 A0A2K2YLL9 Q9CKH7 V4PZ45
WP_005718518.1.10027 WP_005718518.1.10721 WP_005718518.1.11014 WP_005718518.1.11214 WP_005718518.1.11947 WP_005718518.1.12156 WP_005718518.1.12311 WP_005718518.1.1307 WP_005718518.1.14908 WP_005718518.1.15732 WP_005718518.1.17217 WP_005718518.1.17980 WP_005718518.1.18123 WP_005718518.1.19996 WP_005718518.1.20287 WP_005718518.1.21657 WP_005718518.1.22153 WP_005718518.1.2313 WP_005718518.1.23830 WP_005718518.1.24757 WP_005718518.1.26616 WP_005718518.1.26777 WP_005718518.1.27416 WP_005718518.1.27592 WP_005718518.1.27664 WP_005718518.1.28084 WP_005718518.1.29697 WP_005718518.1.30617 WP_005718518.1.34253 WP_005718518.1.35562 WP_005718518.1.35978 WP_005718518.1.36022 WP_005718518.1.3807 WP_005718518.1.38246 WP_005718518.1.3839 WP_005718518.1.39152 WP_005718518.1.3957 WP_005718518.1.40210 WP_005718518.1.40787 WP_005718518.1.41297 WP_005718518.1.41462 WP_005718518.1.41657 WP_005718518.1.42469 WP_005718518.1.42512 WP_005718518.1.42943 WP_005718518.1.43687 WP_005718518.1.44741 WP_005718518.1.45422 WP_005718518.1.47685 WP_005718518.1.4808 WP_005718518.1.49053 WP_005718518.1.50853 WP_005718518.1.51342 WP_005718518.1.52066 WP_005718518.1.52585 WP_005718518.1.52859 WP_005718518.1.53852 WP_005718518.1.55401 WP_005718518.1.57420 WP_005718518.1.57956 WP_005718518.1.58257 WP_005718518.1.58450 WP_005718518.1.58628 WP_005718518.1.58910 WP_005718518.1.59455 WP_005718518.1.60478 WP_005718518.1.60664 WP_005718518.1.61098 WP_005718518.1.61860 WP_005718518.1.62016 WP_005718518.1.6219 WP_005718518.1.62389 WP_005718518.1.6332 WP_005718518.1.63549 WP_005718518.1.65482 WP_005718518.1.65878 WP_005718518.1.66934 WP_005718518.1.66990 WP_005718518.1.70689 WP_005718518.1.72215 WP_005718518.1.73917 WP_005718518.1.74955 WP_005718518.1.75804 WP_005718518.1.78987 WP_005718518.1.79347 WP_005718518.1.79593 WP_005718518.1.80223 WP_005718518.1.80589 WP_005718518.1.80911 WP_005718518.1.81885 WP_005718518.1.8281 WP_005718518.1.83579 WP_005718518.1.86541 WP_005718518.1.87897 WP_005718518.1.89773 WP_005718518.1.90081 WP_005718518.1.90179 WP_005718518.1.90578 WP_005718518.1.91495 WP_005718518.1.94432 WP_005718518.1.94435 WP_005718518.1.95718 WP_005718518.1.9746 WP_005718518.1.9947 gi|15603506|ref|NP_246580.1| gi|383311800|ref|YP_005364610.1| 272843.PM1641 gi|378775709|ref|YP_005177952.1| gi|386835516|ref|YP_006240835.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]