SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603509|ref|NP_246583.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15603509|ref|NP_246583.1|
Domain Number - Region: 140-206
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0832
Family Phosphate binding protein-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603509|ref|NP_246583.1|
Sequence length 325
Comment hypothetical protein PM1644 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKLNLISSAIVLTMFSSASIAASNYTFALSHYGSPSDTVTKATELMAKRAHELSNGRIT
IKLHPNSELGNSGAQIDGVRMGTIDIVVVGNPYYTTFNEELNLLDLPFLFRDETHVEKVL
AGDVGEHLLASFEKVGLKGLAFYEVGFRDITNNKRPISTVKDLSHLKLRTTPNPAHISAF
KEWGVNPTPMPFNEVYFSLKTGVIDGQENPVHHIYNNNLQEVQKYLSLTHHAYTAAPMTM
NLDTFNSLDKETQRILLQVAKEGAELEKQLNIEENKIYLGKLKEQGMEIEYSPDTASFQE
GAKKAWHDYAKKFGDKLINKVVETQ
Download sequence
Identical sequences Q9CKH4
272843.PM1644 gi|15603509|ref|NP_246583.1| WP_010907269.1.12311 WP_010907269.1.15732 WP_010907269.1.19996 WP_010907269.1.40210 WP_010907269.1.45422 WP_010907269.1.4808 WP_010907269.1.53852 WP_010907269.1.6219 WP_010907269.1.62389 WP_010907269.1.66990 WP_010907269.1.81885 WP_010907269.1.8281 WP_010907269.1.89773 WP_010907269.1.9746 WP_010907269.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]