SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603514|ref|NP_246588.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603514|ref|NP_246588.1|
Domain Number 1 Region: 15-333
Classification Level Classification E-value
Superfamily DAK1/DegV-like 2.17e-110
Family DAK1 0.000000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603514|ref|NP_246588.1|
Sequence length 334
Comment hypothetical protein PM1649 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTRKPKKLLNHPNDVPAEQLEGLLYACHGKLSKVEGYSGVIRTDIADQQVVVVTGGGSGH
EPMFAGFVGKGLADAAALGEIFTSPSPDIIIETTKAAQKGQGVLFVYGNYAGDNMNFDIA
AELLEEEGITVKTVRVTDDISAAPPERMQERRGVAGDMYVLKIAGAAVQSGYDLDALHEV
TSKANFNTRTMGVALAACSIPQTGKFNFELADDELELGMGIHGETGVRRQKLTSADEINQ
EIVDRICADIGLQAGDRVCVTINNLGAATYTELLISNRKVHQELAKRGIQVHDTLIGSYC
TSQEMAGYSVTLFRLDDELQKLYDLPCDGFAWRK
Download sequence
Identical sequences A0A1D2NZX4 Q9CKG9
gi|386835524|ref|YP_006240843.1| gi|15603514|ref|NP_246588.1| 272843.PM1649 gi|383311792|ref|YP_005364602.1| WP_005718532.1.11014 WP_005718532.1.11214 WP_005718532.1.11947 WP_005718532.1.12156 WP_005718532.1.12311 WP_005718532.1.14908 WP_005718532.1.15732 WP_005718532.1.17980 WP_005718532.1.19996 WP_005718532.1.21657 WP_005718532.1.26777 WP_005718532.1.27592 WP_005718532.1.28084 WP_005718532.1.35562 WP_005718532.1.36022 WP_005718532.1.3807 WP_005718532.1.38246 WP_005718532.1.3839 WP_005718532.1.3957 WP_005718532.1.40210 WP_005718532.1.41297 WP_005718532.1.41351 WP_005718532.1.41657 WP_005718532.1.41667 WP_005718532.1.42469 WP_005718532.1.42512 WP_005718532.1.43687 WP_005718532.1.45422 WP_005718532.1.4808 WP_005718532.1.49053 WP_005718532.1.51342 WP_005718532.1.52585 WP_005718532.1.52859 WP_005718532.1.53852 WP_005718532.1.55401 WP_005718532.1.57956 WP_005718532.1.58111 WP_005718532.1.58257 WP_005718532.1.60478 WP_005718532.1.61098 WP_005718532.1.6219 WP_005718532.1.62389 WP_005718532.1.6332 WP_005718532.1.63549 WP_005718532.1.66990 WP_005718532.1.70689 WP_005718532.1.72215 WP_005718532.1.78987 WP_005718532.1.79347 WP_005718532.1.79593 WP_005718532.1.81885 WP_005718532.1.8281 WP_005718532.1.83579 WP_005718532.1.88402 WP_005718532.1.89773 WP_005718532.1.90578 WP_005718532.1.92478 WP_005718532.1.93940 WP_005718532.1.94432 WP_005718532.1.95718 WP_005718532.1.9746 WP_005718532.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]