SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603515|ref|NP_246589.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603515|ref|NP_246589.1|
Domain Number 1 Region: 4-330
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 2.56e-85
Family PdxA-like 0.00002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603515|ref|NP_246589.1|
Sequence length 337
Comment 4-hydroxythreonine-4-phosphate dehydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTKSTVALTLGDPAGIGPELVAKLLAKQNIREKANIVLVADKDELEKGMEIAKAQFVYEE
VSFHQLGQYEFKTGVPVLISHKSSHPKPFEYGKVTEQSGVYILETLKVALNLAKMGYVQA
ICFAPLNKQAMHKGGLRYRDELHWFAEQTDFNEFVCELNVVDDIWAARVTSHIPFKDIVP
NLSIKGVFDCIHLLYRSLVQAGVENPKIAVQALNPHGGEGGVFGDEEMTIIQPGMEQARK
AGIDVYGPFPGDTTMREVERLKINGVVSMYHDQFSTALKILGFERGVTVQGGIPIPITTA
NHGTAFDLHGKNIAIPTAFEAAFNIAVRMGQGVLNQK
Download sequence
Identical sequences A0A1E3XM12 Q9CKG8 V4MS52
gi|15603515|ref|NP_246589.1| 272843.PM1650 gi|378775700|ref|YP_005177943.1| WP_005718533.1.10027 WP_005718533.1.10721 WP_005718533.1.11014 WP_005718533.1.11214 WP_005718533.1.11947 WP_005718533.1.12156 WP_005718533.1.12311 WP_005718533.1.1307 WP_005718533.1.15732 WP_005718533.1.17217 WP_005718533.1.17980 WP_005718533.1.18123 WP_005718533.1.19996 WP_005718533.1.20287 WP_005718533.1.21657 WP_005718533.1.22153 WP_005718533.1.2313 WP_005718533.1.23830 WP_005718533.1.26616 WP_005718533.1.26777 WP_005718533.1.27416 WP_005718533.1.27592 WP_005718533.1.28084 WP_005718533.1.29697 WP_005718533.1.30617 WP_005718533.1.34253 WP_005718533.1.35562 WP_005718533.1.35978 WP_005718533.1.3807 WP_005718533.1.38246 WP_005718533.1.3839 WP_005718533.1.39152 WP_005718533.1.40210 WP_005718533.1.41297 WP_005718533.1.41351 WP_005718533.1.41462 WP_005718533.1.41657 WP_005718533.1.41667 WP_005718533.1.42469 WP_005718533.1.42943 WP_005718533.1.43687 WP_005718533.1.44741 WP_005718533.1.45422 WP_005718533.1.47685 WP_005718533.1.4808 WP_005718533.1.49053 WP_005718533.1.50853 WP_005718533.1.51342 WP_005718533.1.52066 WP_005718533.1.52585 WP_005718533.1.52859 WP_005718533.1.53852 WP_005718533.1.55401 WP_005718533.1.57420 WP_005718533.1.57956 WP_005718533.1.58111 WP_005718533.1.58257 WP_005718533.1.58450 WP_005718533.1.58628 WP_005718533.1.58910 WP_005718533.1.59455 WP_005718533.1.60478 WP_005718533.1.60664 WP_005718533.1.61860 WP_005718533.1.62016 WP_005718533.1.6219 WP_005718533.1.62389 WP_005718533.1.6332 WP_005718533.1.63549 WP_005718533.1.65482 WP_005718533.1.65878 WP_005718533.1.66934 WP_005718533.1.66990 WP_005718533.1.70689 WP_005718533.1.72215 WP_005718533.1.73917 WP_005718533.1.74955 WP_005718533.1.75804 WP_005718533.1.78987 WP_005718533.1.79347 WP_005718533.1.79593 WP_005718533.1.80223 WP_005718533.1.80589 WP_005718533.1.80911 WP_005718533.1.81885 WP_005718533.1.8281 WP_005718533.1.83579 WP_005718533.1.86541 WP_005718533.1.87897 WP_005718533.1.88402 WP_005718533.1.89773 WP_005718533.1.90179 WP_005718533.1.90578 WP_005718533.1.91495 WP_005718533.1.92478 WP_005718533.1.93940 WP_005718533.1.94432 WP_005718533.1.94435 WP_005718533.1.9746 WP_005718533.1.9947 gi|383311791|ref|YP_005364601.1| gi|386835525|ref|YP_006240844.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]