SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603522|ref|NP_246596.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603522|ref|NP_246596.1|
Domain Number 1 Region: 105-308
Classification Level Classification E-value
Superfamily HAD-like 3.25e-49
Family Phosphoserine phosphatase 0.0000554
Further Details:      
 
Weak hits

Sequence:  gi|15603522|ref|NP_246596.1|
Domain Number - Region: 21-96
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.00812
Family Enolase N-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603522|ref|NP_246596.1|
Sequence length 320
Comment phosphoserine phosphatase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQTQNLATITQFFSSFPCSITSSEPVTEGKTHIVVYGETLNLLKLRQFQQKCGENFIILE
AWNVLHNTVVLLRGDWHTQWLDYAHELGLDCALLDFSPRLAQAGLLVMDMDSTAIQIECI
DEIAKLAGTGELVSSITAQAMRGELDFEQSLRRRVSTLKGAPETILKTVRDNLPLMPGLE
DTLAVLQQYGWKTAIASGGFTYFTDYLKQRLKLDYTVANQFAIEEGILTGEVAGDVVDAQ
YKARTLGELAEKFNIALQQTVAIGDGANDLAMLSVAGMGVALHAKPKVQQQAKVVVNFAD
FSALLCLLSANDKLVKANKE
Download sequence
Identical sequences Q9CKG1
gi|15603522|ref|NP_246596.1| 272843.PM1657 WP_010907276.1.12311 WP_010907276.1.15732 WP_010907276.1.19996 WP_010907276.1.40210 WP_010907276.1.45422 WP_010907276.1.4808 WP_010907276.1.53852 WP_010907276.1.6219 WP_010907276.1.62389 WP_010907276.1.66990 WP_010907276.1.8281 WP_010907276.1.89773 WP_010907276.1.9746 WP_010907276.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]